| blob | 836d8e501468ccbadf0e44efa179e439c89192b2 |
1 /* packet-infiniband.c
2 * Routines for Infiniband/ERF Dissection
3 * Copyright 2008 Endace Technology Limited
4 *
5 * Wireshark - Network traffic analyzer
6 * By Gerald Combs <gerald@wireshark.org>
7 * Copyright 1998 Gerald Combs
8 *
9 * Modified 2010 by Mellanox Technologies Ltd.
10 *
11 * SPDX-License-Identifier: GPL-2.0-or-later
12 */
16 #include <epan/packet.h>
17 #include <epan/exceptions.h>
18 #include <epan/conversation.h>
19 #include <epan/prefs.h>
20 #include <epan/etypes.h>
21 #include <epan/show_exception.h>
22 #include <epan/decode_as.h>
23 #include <wiretap/erf_record.h>
24 #include <wiretap/wtap.h>
31 /*Default RRoce UDP port*/
32 #define DEFAULT_RROCE_UDP_PORT 4791
34 /* service id prefix 0x0000000001 is designated for
35 * RDMA IP CM service as per Annex A11.2
36 */
37 #define RDMA_IP_CM_SID_PREFIX_MASK 0xFFFFFFFFFF000000
38 #define RDMA_IP_CM_SID_PREFIX 0x0000000001000000
40 /* Wireshark ID */
44 /* Variables to hold expansion values between packets */
45 /* static int ett_infiniband; */
74 /* static int ett_nodedesc; */
75 /* static int ett_nodeinfo; */
76 /* static int ett_switchinfo; */
77 /* static int ett_guidinfo; */
78 /* static int ett_portinfo; */
101 /* Dissector Declaration */
105 /* Subdissectors Declarations */
112 /* MAD_Data
113 * Structure to hold information from the common MAD header.
114 * This is necessary because the MAD header contains information which significantly changes the dissection algorithm. */
130 IB_PACKET_STARTS_WITH_BTH /* RROCE packet */
133 /* Forward-declarations */
135 static void dissect_infiniband_common(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree, ib_packet_start_header starts_with);
138 static void dissect_general_info(tvbuff_t *tvb, int offset, packet_info *pinfo, ib_packet_start_header starts_with);
140 /* Parsing Methods for specific IB headers. */
143 static void parse_PAYLOAD(proto_tree *, packet_info *, struct infinibandinfo *, tvbuff_t *, int *, int length, int crclen, proto_tree *);
164 static void parse_COM_MGT(proto_tree *parentTree, packet_info *pinfo, tvbuff_t *tvb, int *offset, proto_tree* top_tree);
177 /* Class Attribute Parsing Routines */
181 /* These methods parse individual attributes
182 * Naming convention FunctionHandle = "parse_" + [Attribute Name];
183 * Where [Attribute Name] is the attribute identifier from chapter 14 of the IB Specification
184 * Subnet Management */
202 /* These methods parse individual attributes for specific MAD management classes.
203 * Naming convention FunctionHandle = "parse_" + [Management Class] + "_" + [Attribute Name];
204 * Where [Management Class] is the shorthand name for the management class as defined
205 * in the MAD Management Classes section below in this file, and [Attribute Name] is the
206 * attribute identifier from the corresponding chapter of the IB Specification */
207 static int parse_PERF_PortCounters(proto_tree* parentTree, tvbuff_t* tvb, packet_info *pinfo, int *offset);
208 static int parse_PERF_PortCountersExtended(proto_tree* parentTree, tvbuff_t* tvb, packet_info *pinfo, int *offset);
210 /* Subnet Administration */
220 /* Subnet Administration */
223 /* Common */
226 /* SM Methods */
234 };
235 /* SM Attributes */
254 };
256 /* SA Methods */
271 };
272 /* SA Attributes */
298 };
300 /* CM Attributes */
315 };
317 /* RMPP Types */
318 #define RMPP_NOT_USED 0
319 #define RMPP_DATA 1
320 #define RMPP_ACK 2
321 #define RMPP_STOP 3
322 #define RMPP_ABORT 4
331 };
339 };
355 };
364 };
384 };
393 };
400 };
407 };
415 };
426 };
432 };
438 };
447 };
455 };
463 };
471 };
480 };
482 /* For reserved fields in various packets */
484 /* Local Route Header (LRH) */
495 /* Global Route Header (GRH) */
505 /* Base Transport Header (BTH) */
517 /* Raw Header (RWH) */
520 /* Reliable Datagram Extended Transport Header (RDETH) */
523 /* Datagram Extended Transport Header (DETH) */
527 /* RDMA Extended Transport Header (RETH) */
532 /* Atomic Extended Transport Header (AtomicETH) */
534 /* static int hf_infiniband_virtual_address_AtomicETH; */
535 /* static int hf_infiniband_remote_key_AtomicETH; */
538 /* ACK Extended Transport Header (AETH) */
548 /* Atomic ACK Extended Transport Header (AtomicAckETH) */
551 /* Immediate Extended Transport Header (ImmDt) */
553 /* Invalidate Extended Transport Header (IETH) */
555 /* FLUSH Extended Transport Header (FETH) */
561 /* Payload */
565 /* Unknown or Vendor Specific */
568 /* CM REQ Header */
637 /* CM REP Header */
654 /* CM RTU Header */
658 /* CM REJ Header */
668 /* CM DREQ Header */
673 /* CM DRSP Header */
677 /* MAD Base Header */
689 /* RMPP Header */
698 /* RMPP Data */
699 /* static int hf_infiniband_RMPP_DATA; */
703 /* RMPP ACK */
705 /* RMPP ABORT and STOP */
707 /* SMP Data LID Routed */
711 /* SMP Data Directed Route */
721 /* SA MAD Header */
728 /* Mellanox EoIB encapsulation header */
740 #define MELLANOX_VERSION_FLAG 0x3000
741 #define MELLANOX_TCP_CHECKSUM_FLAG 0x0C00
742 #define MELLANOX_IP_CHECKSUM_FLAG 0x0300
743 #define MELLANOX_FCS_PRESENT_FLAG 0x0040
744 #define MELLANOX_MORE_SEGMENT_FLAG 0x0020
745 #define MELLANOX_SEGMENT_FLAG 0x001F
747 /* Attributes
748 * Additional Structures for individuala attribute decoding.
749 * Since they are not headers the naming convention is slightly modified
750 * Convention: hf_infiniband_[attribute name]_[field]
751 * This was not entirely necessary but I felt the previous convention
752 * did not provide adequate readability for the granularity of attribute/attribute fields. */
754 /* NodeDescription */
756 /* NodeInfo */
769 /* SwitchInfo */
787 /* GUIDInfo */
788 /* static int hf_infiniband_GUIDInfo_GUIDBlock; */
790 /* PortInfo */
796 /* Capability Mask Flags */
821 /* End Capability Mask Flags */
867 /* P_KeyTable */
872 /* SLtoVLMappingTable */
876 /* VLArbitrationTable */
877 /* static int hf_infiniband_VLArbitrationTable_VLWeightPairs; */
881 /* LinearForwardingTable */
882 /* static int hf_infiniband_LinearForwardingTable_LinearForwardingTableBlock; */
885 /* RandomForwardingTable */
886 /* static int hf_infiniband_RandomForwardingTable_RandomForwardingTableBlock; */
892 /* MulticastForwardingTable */
893 /* static int hf_infiniband_MulticastForwardingTable_MulticastForwardingTableBlock; */
896 /* SMInfo */
903 /* VendorDiag */
907 /* LedInfo */
910 /* LinkSpeedWidthPairsTable */
917 /* Attributes for Subnet Administration.
918 * Mostly we have "Records" here which are just structures of SM attributes.
919 * There are some unique attributes though that we will want to have a structure for. */
921 /* NodeRecord */
922 /* PortInfoRecord */
923 /* SLtoVLMappingTableRecord */
924 /* SwitchInfoRecord */
925 /* LinearForwardingTableRecord */
926 /* RandomForwardingTableRecord */
927 /* MulticastForwardingTableRecord */
928 /* VLArbitrationTableRecord */
939 /* static int hf_infiniband_SA_Index; */
941 /* InformInfoRecord */
945 /* InformInfo */
957 /* LinkRecord */
963 /* ServiceRecord */
972 /* ServiceAssociationRecord */
976 /* PathRecord */
997 /* MCMemberRecord */
1017 /* TraceRecord */
1028 /* MultiPathRecord */
1049 /* ClassPortInfo */
1073 /* Notice */
1082 /* static int hf_infiniband_Notice_IssuerGID; */
1083 /* static int hf_infiniband_Notice_ClassTrapSpecificData; */
1085 /* ClassPortInfo attribute in Performance class */
1088 /* PortCounters attribute in Performance class */
1109 /* Extended PortCounters attribute in Performance class */
1122 /* Notice DataDetails and ClassTrapSpecific Data for certain traps
1123 * Note that traps reuse many fields, so they are only declared once under the first trap that they appear.
1124 * There is no need to redeclare them for specific Traps (as with other SA Attributes) because they are uniform between Traps. */
1126 /* Parse DataDetails for a given Trap */
1129 /* Traps 64,65,66,67 */
1132 /* Traps 68,69 */
1133 /* DataDetails */
1136 /* ClassTrapSpecificData */
1137 /* static int hf_infiniband_Trap_PATH_REC; */
1139 /* Trap 128 */
1142 /* Trap 129, 130, 131 */
1145 /* Trap 144 */
1152 /* Trap 145 */
1155 /* Trap 256 */
1166 /* Trap 257, 258 */
1176 /* Trap 259 */
1181 /* Infiniband Link */
1188 /* Trap Type/Descriptions for dissection */
1193 };
1195 /* Trap Type/Descriptions for dissection */
1207 { 144, " (Informational) CapMask, NodeDesc, LinkWidthEnabled or LinkSpeedEnabled at <LIDADDR> has been modified"},
1208 { 145, " (Informational) SystemImageGUID at <LIDADDR> has been modified. New value is <SYSTEMIMAGEGUID>"},
1209 { 256, " (Security) Bad M_Key, <M_KEY> from <LIDADDR> attempted <METHOD> with <ATTRIBUTEID> and <ATTRIBUTEMODIFIER>"},
1210 { 257, " (Security) Bad P_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL>"},
1211 { 258, " (Security) Bad Q_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL>"},
1212 { 259, " (Security) Bad P_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL> at switch <LIDADDR><PORTNO>"},
1214 };
1309 };
1311 #define AETH_SYNDROME_OPCODE_ACK 0
1312 #define AETH_SYNDROME_OPCODE_RNR_NAK 1
1313 #define AETH_SYNDROME_OPCODE_RES 2
1314 #define AETH_SYNDROME_OPCODE_NAK 3
1322 };
1331 };
1367 };
1369 /* MAD Management Classes
1370 * Classes from the Common MAD Header
1371 *
1372 * Management Class Name Class Description
1373 * ------------------------------------------------------------------------------------------------------------ */
1378 #define BM 0x05 /* Baseboard Management (Tunneling of IB-ML commands through the IBA subnet) */
1389 /* Performance class Attributes */
1390 #define ATTR_PORT_COUNTERS 0x0012
1391 #define ATTR_PORT_COUNTERS_EXT 0x001D
1393 /* Link Next Header Values */
1394 #define IBA_GLOBAL 3
1395 #define IBA_LOCAL 2
1396 #define IP_NON_IBA 1
1397 #define RAW 0
1400 {
1468 };
1470 /* Mellanox DCT has the same opcodes as RD so will use the same RD macros */
1472 {
1496 };
1498 /* Header Ordering Based on OPCODES
1499 * These are simply an enumeration of the possible header combinations defined by the IB Spec.
1500 * These enumerations
1501 * #DEFINE [HEADER_ORDER] [ENUM]
1502 * __________________________________ */
1503 #define RDETH_DETH_PAYLD 0
1504 /* __________________________________ */
1505 #define RDETH_DETH_RETH_PAYLD 1
1506 /* __________________________________ */
1507 #define RDETH_DETH_IMMDT_PAYLD 2
1508 /* __________________________________ */
1509 #define RDETH_DETH_RETH_IMMDT_PAYLD 3
1510 /* __________________________________ */
1511 #define RDETH_DETH_RETH 4
1512 /* __________________________________ */
1513 #define RDETH_AETH_PAYLD 5
1514 /* __________________________________ */
1515 #define RDETH_PAYLD 6
1516 /* __________________________________ */
1517 #define RDETH_AETH 7
1518 /* __________________________________ */
1519 #define RDETH_AETH_ATOMICACKETH 8
1520 /* __________________________________ */
1521 #define RDETH_DETH_ATOMICETH 9
1522 /* ___________________________________ */
1523 #define RDETH_DETH 10
1524 /* ___________________________________ */
1525 #define DETH_PAYLD 11
1526 /* ___________________________________ */
1527 #define DETH_IMMDT_PAYLD 12
1528 /* ___________________________________ */
1529 #define PAYLD 13
1530 /* ___________________________________ */
1531 #define IMMDT_PAYLD 14
1532 /* ___________________________________ */
1533 #define RETH_PAYLD 15
1534 /* ___________________________________ */
1535 #define RETH_IMMDT_PAYLD 16
1536 /* ___________________________________ */
1537 #define RETH 17
1538 /* ___________________________________ */
1539 #define AETH_PAYLD 18
1540 /* ___________________________________ */
1541 #define AETH 19
1542 /* ___________________________________ */
1543 #define AETH_ATOMICACKETH 20
1544 /* ___________________________________ */
1545 #define ATOMICETH 21
1546 /* ___________________________________ */
1547 #define IETH_PAYLD 22
1548 /* ___________________________________ */
1549 #define DCCETH 23
1550 /* ___________________________________ */
1551 #define FETH_RETH 24
1552 /* ___________________________________ */
1553 #define RDETH_FETH_RETH 25
1554 /* ___________________________________ */
1555 #define RDETH_RETH_PAYLD 26
1556 /* ___________________________________ */
1559 /* Infiniband transport services
1560 These are an enumeration of the transport services over which an IB packet
1561 might be sent. The values match the corresponding 3 bits of the opCode field
1562 in the BTH */
1563 #define TRANSPORT_RC 0
1564 #define TRANSPORT_UC 1
1565 #define TRANSPORT_RD 2
1566 #define TRANSPORT_UD 3
1568 #define AETH_SYNDROME_RES 0x80
1569 #define AETH_SYNDROME_OPCODE 0x60
1570 #define AETH_SYNDROME_VALUE 0x1F
1573 /* Array of all availavle OpCodes to make matching a bit easier.
1574 * The OpCodes dictate the header sequence following in the packet.
1575 * These arrays tell the dissector which headers must be decoded for the given OpCode. */
1577 RD_CMP_SWAP,
1578 RD_FETCH_ADD
1579 };
1581 RC_SEND_LAST_INVAL,
1582 RC_SEND_ONLY_INVAL
1583 };
1585 RC_CMP_SWAP,
1586 RC_FETCH_ADD
1587 };
1589 RD_RDMA_WRITE_FIRST,
1590 RD_RDMA_WRITE_ONLY
1591 };
1593 RC_RDMA_WRITE_ONLY_IMM,
1594 UC_RDMA_WRITE_ONLY_IMM
1595 };
1597 RD_SEND_LAST_IMM,
1598 RD_SEND_ONLY_IMM,
1599 RD_RDMA_WRITE_LAST_IMM
1600 };
1603 RD_RDMA_READ_RESPONSE_FIRST,
1604 RD_RDMA_READ_RESPONSE_LAST,
1605 RD_RDMA_READ_RESPONSE_ONLY
1606 };
1608 RC_RDMA_READ_RESPONSE_FIRST,
1609 RC_RDMA_READ_RESPONSE_LAST,
1610 RC_RDMA_READ_RESPONSE_ONLY
1611 };
1613 RC_RDMA_WRITE_FIRST,
1614 RC_RDMA_WRITE_ONLY,
1615 UC_RDMA_WRITE_FIRST,
1616 UC_RDMA_WRITE_ONLY
1617 };
1620 RD_SEND_FIRST,
1621 RD_SEND_MIDDLE,
1622 RD_SEND_LAST,
1623 RD_SEND_ONLY,
1624 RD_RDMA_WRITE_MIDDLE,
1625 RD_RDMA_WRITE_LAST
1626 };
1629 RC_SEND_LAST_IMM,
1630 RC_SEND_ONLY_IMM,
1631 RC_RDMA_WRITE_LAST_IMM,
1632 UC_SEND_LAST_IMM,
1633 UC_SEND_ONLY_IMM,
1634 UC_RDMA_WRITE_LAST_IMM
1635 };
1638 RC_SEND_FIRST,
1639 RC_SEND_MIDDLE,
1640 RC_SEND_LAST,
1641 RC_SEND_ONLY,
1642 RC_RDMA_WRITE_MIDDLE,
1643 RC_RDMA_WRITE_LAST,
1644 RC_RDMA_READ_RESPONSE_MIDDLE,
1645 UC_SEND_FIRST,
1646 UC_SEND_MIDDLE,
1647 UC_SEND_LAST,
1648 UC_SEND_ONLY,
1649 UC_RDMA_WRITE_MIDDLE,
1650 UC_RDMA_WRITE_LAST
1651 };
1653 /* It is not necessary to create arrays for these OpCodes since they indicate only one further header.
1654 * We can just decode it directly
1656 * static uint32_t opCode_DETH_IMMDT_PAYLD[] = {
1657 * UD_SEND_ONLY_IMM
1658 * };
1659 * static uint32_t opCode_DETH_PAYLD[] = {
1660 * UD_SEND_ONLY
1661 * };
1662 * static uint32_t opCode_RDETH_DETH[] = {
1663 * RD_RESYNC
1664 * };
1665 * static uint32_t opCode_RDETH_DETH_RETH[] = {
1666 * RD_RDMA_READ_REQUEST
1667 * };
1668 * static uint32_t opCode_RDETH_DETH_RETH_IMMDT_PAYLD[] = {
1669 * RD_RDMA_WRITE_ONLY_IMM
1670 * };
1671 * static uint32_t opCode_RDETH_AETH_ATOMICACKETH[] = {
1672 * RD_ATOMIC_ACKNOWLEDGE
1673 * };
1674 * static uint32_t opCode_RDETH_AETH[] = {
1675 * RD_ACKNOWLEDGE
1676 * };
1677 * static uint32_t opCode_RDETH_PAYLD[] = {
1678 * RD_RDMA_READ_RESPONSE_MIDDLE
1679 * };
1680 * static uint32_t opCode_AETH_ATOMICACKETH[] = {
1681 * RC_ATOMIC_ACKNOWLEDGE
1682 * };
1683 * static uint32_t opCode_RETH[] = {
1684 * RC_RDMA_READ_REQUEST
1685 * };
1686 * static uint32_t opCode_AETH[] = {
1687 * RC_ACKNOWLEDGE
1688 * }; */
1690 /* settings to be set by the user via the preferences dialog */
1694 /* saves information about connections that have been/are in the process of being
1695 negotiated via ConnectionManagement packets */
1706 /* holds a table of connection contexts being negotiated by CM. the key is a obtained
1707 using add_address_to_hash64(initiator address, TransactionID) */
1710 /* heuristics sub-dissectors list for dissecting the data payload of IB packets */
1712 /* heuristics sub-dissectors list for dissecting the PrivateData of CM packets */
1715 /* ----- This sections contains various utility functions indirectly related to Infiniband dissection ---- */
1717 {
1719 }
1723 }
1725 /* --------------------------------------------------------------------------------------------------------*/
1726 /* Helper dissector for correctly dissecting RRoCE packets (encapsulated within an IP */
1727 /* frame). The only difference from regular IB packets is that RRoCE packets do not contain */
1728 /* a LRH, and always start with a BTH. */
1729 static int
1731 {
1732 /* this is a RRoCE packet, so signal the IB dissector not to look for LRH/GRH */
1735 }
1737 /* Helper dissector for correctly dissecting RoCE packets (encapsulated within an Ethernet */
1738 /* frame). The only difference from regular IB packets is that RoCE packets do not contain */
1739 /* a LRH, and always start with a GRH. */
1740 static int
1742 {
1743 /* this is a RoCE packet, so signal the IB dissector not to look for LRH */
1746 }
1748 static int
1750 {
1753 }
1755 /* Common Dissector for both InfiniBand and RoCE packets
1756 * IN:
1757 * tvb - The tvbbuff of packet data
1758 * pinfo - The packet info structure with column information
1759 * tree - The tree structure under which field nodes are to be added
1760 * starts_with - regular IB packet starts with LRH, ROCE starts with GRH and RROCE starts with BTH,
1761 * this tells the parser what headers of (LRH/GRH) to skip.
1762 * Notes:
1763 * 1.) Floating "offset+=" statements should probably be "functionized" but they are inline
1764 * Offset is only passed by reference in specific places, so do not be confused when following code
1765 * In any code path, adding up "offset+=" statements will tell you what byte you are at */
1766 static void
1767 dissect_infiniband_common(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree, ib_packet_start_header starts_with)
1768 {
1769 /* Top Level Item */
1772 /* The Headers Subtree */
1775 /* BTH - Base Transport Header */
1779 /* LRH - Local Route Header */
1783 /* Raw Data */
1788 /* General Variables */
1789 bool bthFollows = false; /* Tracks if we are parsing a BTH. This is a significant decision point */
1791 int32_t nextHeaderSequence = -1; /* defined by this dissector. #define which indicates the upcoming header sequence from OpCode */
1794 /* It provides the parsing methods a known size */
1795 /* that must be available for that header. */
1802 pinfo->srcport = pinfo->destport = 0xffffffff; /* set the src/dest QPN to something impossible instead of the default 0,
1803 so we don't mistake it for a MAD. (QP is only 24bit, so can't be 0xffffffff)*/
1807 /* Mark the Packet type as Infiniband in the wireshark UI */
1808 /* Clear other columns */
1812 /* Top Level Packet */
1815 /* Headers Level Tree */
1819 /* this is a RoCE packet, skip LRH parsing */
1825 }
1827 /* this is a RRoCE packet, skip LRH/GRH parsing and go directly to BTH */
1833 }
1835 /* Local Route Header Subtree */
1836 local_route_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_LRH, tvb, offset, 8, ENC_NA);
1840 proto_tree_add_item(local_route_header_tree, hf_infiniband_virtual_lane, tvb, offset, 1, ENC_BIG_ENDIAN);
1842 proto_tree_add_item(local_route_header_tree, hf_infiniband_link_version, tvb, offset, 1, ENC_BIG_ENDIAN);
1844 proto_tree_add_item(local_route_header_tree, hf_infiniband_service_level, tvb, offset, 1, ENC_BIG_ENDIAN);
1847 proto_tree_add_item(local_route_header_tree, hf_infiniband_link_next_header, tvb, offset, 1, ENC_BIG_ENDIAN);
1850 /* Save Link Next Header... This tells us what the next header is. */
1856 proto_tree_add_item(local_route_header_tree, hf_infiniband_destination_local_id, tvb, offset, 2, ENC_BIG_ENDIAN);
1859 /* Set destination in packet view. */
1866 proto_tree_add_item(local_route_header_tree, hf_infiniband_reserved5, tvb, offset, 2, ENC_BIG_ENDIAN);
1868 packetLength = tvb_get_ntohs(tvb, offset); /* Get the Packet Length. This will determine payload size later on. */
1870 packetLength = packetLength * 4; /* Multiply by 4 to get true byte length. This is by specification. */
1871 /* PktLen is size in 4 byte words (byteSize /4). */
1873 proto_tree_add_item(local_route_header_tree, hf_infiniband_packet_length, tvb, offset, 2, ENC_BIG_ENDIAN);
1875 proto_tree_add_item(local_route_header_tree, hf_infiniband_source_local_id, tvb, offset, 2, ENC_BIG_ENDIAN);
1877 /* Set Source in packet view. */
1885 skip_lrh:
1887 /* Key off Link Next Header. This tells us what High Level Data Format we have */
1889 {
1894 global_route_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_GRH, tvb, offset, 40, ENC_NA);
1898 proto_tree_add_item(global_route_header_tree, hf_infiniband_ip_version, tvb, offset, 1, ENC_BIG_ENDIAN);
1899 proto_tree_add_item(global_route_header_tree, hf_infiniband_traffic_class, tvb, offset, 2, ENC_BIG_ENDIAN);
1900 proto_tree_add_item(global_route_header_tree, hf_infiniband_flow_label, tvb, offset, 4, ENC_BIG_ENDIAN);
1903 proto_tree_add_item(global_route_header_tree, hf_infiniband_payload_length, tvb, offset, 2, ENC_BIG_ENDIAN);
1908 proto_tree_add_item(global_route_header_tree, hf_infiniband_next_header, tvb, offset, 1, ENC_BIG_ENDIAN);
1910 proto_tree_add_item(global_route_header_tree, hf_infiniband_hop_limit, tvb, offset, 1, ENC_BIG_ENDIAN);
1912 proto_tree_add_item(global_route_header_tree, hf_infiniband_source_gid, tvb, offset, 16, ENC_NA);
1914 /* set source GID in packet view*/
1918 proto_tree_add_item(global_route_header_tree, hf_infiniband_destination_gid, tvb, offset, 16, ENC_NA);
1919 /* set destination GID in packet view*/
1926 {
1927 /* Some kind of packet being transported globally with IBA, but locally it is not IBA - no BTH following. */
1929 }
1930 }
1931 /* otherwise fall through and start parsing BTH */
1932 /* FALL THROUGH */
1937 /* Get the OpCode - this tells us what headers are following */
1945 }
1947 base_transport_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_BTH, tvb, offset, bthSize, ENC_NA);
1950 proto_tree_add_item(base_transport_header_tree, hf_infiniband_opcode, tvb, offset, 1, ENC_BIG_ENDIAN);
1953 /* since DCT uses the same opcodes as RD we will use another name mapping */
1954 col_append_str(pinfo->cinfo, COL_INFO, val_to_str_const((uint32_t)info.opCode, DctOpCodeMap, "Unknown OpCode "));
1955 }
1957 col_append_str(pinfo->cinfo, COL_INFO, val_to_str_const((uint32_t)info.opCode, OpCodeMap, "Unknown OpCode "));
1958 }
1961 proto_tree_add_item(base_transport_header_tree, hf_infiniband_solicited_event, tvb, offset, 1, ENC_BIG_ENDIAN);
1962 proto_tree_add_item(base_transport_header_tree, hf_infiniband_migreq, tvb, offset, 1, ENC_BIG_ENDIAN);
1963 proto_tree_add_item(base_transport_header_tree, hf_infiniband_pad_count, tvb, offset, 1, ENC_BIG_ENDIAN);
1964 proto_tree_add_item(base_transport_header_tree, hf_infiniband_transport_header_version, tvb, offset, 1, ENC_BIG_ENDIAN);
1966 proto_tree_add_item(base_transport_header_tree, hf_infiniband_partition_key, tvb, offset, 2, ENC_BIG_ENDIAN);
1968 proto_tree_add_item(base_transport_header_tree, hf_infiniband_reserved, tvb, offset, 1, ENC_NA);
1970 proto_tree_add_item_ret_uint(base_transport_header_tree, hf_infiniband_destination_qp, tvb, offset, 3, ENC_BIG_ENDIAN, &pinfo->destport);
1973 proto_tree_add_item(base_transport_header_tree, hf_infiniband_acknowledge_request, tvb, offset, 1, ENC_BIG_ENDIAN);
1974 proto_tree_add_item(base_transport_header_tree, hf_infiniband_reserved7, tvb, offset, 1, ENC_BIG_ENDIAN);
1976 proto_tree_add_item_ret_uint(base_transport_header_tree, hf_infiniband_packet_sequence_number, tvb, offset, 3, ENC_BIG_ENDIAN, &info.packet_seq_num);
1980 }
1983 /* Raw IPv6 Packet */
1993 /* Unknown Packet */
1994 RAWDATA_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_raw_data, tvb, offset, -1, ENC_NA);
1997 }
1999 /* Base Transport header is hit quite often, however it is alone since it is the exception not the rule */
2000 /* Only IBA Local packets use it */
2002 {
2003 /* Find our next header sequence based on the Opcode
2004 * Each case decrements the packetLength by the amount of bytes consumed by each header.
2005 * The find_next_header_sequence method could be used to automate this.
2006 * We need to keep track of this so we know much data to mark as payload/ICRC/VCRC values. */
2010 /* find_next_header_sequence gives us the DEFINE value corresponding to the header order following */
2011 /* Enumerations are named intuitively, e.g. RDETH DETH PAYLOAD means there is an RDETH Header, DETH Header, and a packet payload */
2013 {
2240 }
2242 }
2243 /* Display the ICRC/VCRC */
2244 /* Doing it this way rather than in a variety of places according to the specific packet */
2245 /* If we've already displayed it crc_length comes out 0 */
2248 {
2249 proto_tree_add_item(all_headers_tree, hf_infiniband_invariant_crc, tvb, offset, 4, ENC_BIG_ENDIAN);
2251 proto_tree_add_item(all_headers_tree, hf_infiniband_variant_crc, tvb, offset, 2, ENC_BIG_ENDIAN);
2253 }
2255 {
2256 proto_tree_add_item(all_headers_tree, hf_infiniband_invariant_crc, tvb, offset, 4, ENC_BIG_ENDIAN);
2258 }
2260 {
2261 proto_tree_add_item(all_headers_tree, hf_infiniband_variant_crc, tvb, offset, 2, ENC_BIG_ENDIAN);
2263 }
2265 }
2267 static int
2269 {
2270 /* Top Level Item */
2273 /* The Link Subtree */
2283 /* Mark the Packet type as Infiniband in the wireshark UI */
2284 /* Clear other columns */
2289 /* Assigns column values */
2292 /* Top Level Packet */
2293 infiniband_link_packet = proto_tree_add_item(tree, proto_infiniband_link, tvb, offset, -1, ENC_NA);
2295 /* Headers Level Tree */
2298 operand_item = proto_tree_add_item(link_tree, hf_infiniband_link_op, tvb, offset, 2, ENC_BIG_ENDIAN);
2312 }
2315 }
2318 /* Description: Finds the header sequence that follows the Base Transport Header.
2319 * Somwhat inefficient (should be using a single key,value pair data structure)
2320 * But uses pure probablity to take a stab at better efficiency.
2321 * Searches largest header sequence groups first, and then finally resorts to single matches for unique header sequences
2322 * IN: OpCode: The OpCode from the Base Transport Header.
2323 * OUT: The Header Sequence enumeration. See Declarations for #defines from (0-22) */
2324 static int32_t
2326 {
2333 if (contains(ibInfo->opCode, &opCode_IMMDT_PAYLD[0], (int32_t)array_length(opCode_IMMDT_PAYLD)))
2336 if (contains(ibInfo->opCode, &opCode_RDETH_DETH_PAYLD[0], (int32_t)array_length(opCode_RDETH_DETH_PAYLD)))
2342 if (contains(ibInfo->opCode, &opCode_RDETH_AETH_PAYLD[0], (int32_t)array_length(opCode_RDETH_AETH_PAYLD)))
2348 if (contains(ibInfo->opCode, &opCode_RDETH_DETH_IMMDT_PAYLD[0], (int32_t)array_length(opCode_RDETH_DETH_IMMDT_PAYLD)))
2351 if (contains(ibInfo->opCode, &opCode_RETH_IMMDT_PAYLD[0], (int32_t)array_length(opCode_RETH_IMMDT_PAYLD)))
2354 if (contains(ibInfo->opCode, &opCode_RDETH_DETH_RETH_PAYLD[0], (int32_t)array_length(opCode_RDETH_DETH_RETH_PAYLD)))
2363 if (contains(ibInfo->opCode, &opCode_RDETH_DETH_ATOMICETH[0], (int32_t)array_length(opCode_RDETH_DETH_ATOMICETH)))
2412 }
2414 /* Description: Finds if a given value is present in an array. This is probably in a standard library somewhere,
2415 * But I'd rather define my own.
2416 * IN: OpCode: The OpCode you are looking for
2417 * IN: Codes: The organized array of OpCodes to look through
2418 * IN: Array length, because we're in C++...
2419 * OUT: Boolean indicating if that OpCode was found in OpCodes */
2420 static bool
2422 {
2425 {
2428 }
2430 }
2432 /* Parse RDETH - Reliable Datagram Extended Transport Header
2433 * IN: parentTree to add the dissection to - in this code the all_headers_tree
2434 * IN: tvb - the data buffer from wireshark
2435 * IN/OUT: The current and updated offset */
2436 static void
2438 {
2440 /* RDETH - Reliable Datagram Extended Transport Header */
2444 RDETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_RDETH, tvb, local_offset, 4, ENC_NA);
2445 proto_item_set_text(RDETH_header_item, "%s", "RDETH - Reliable Datagram Extended Transport Header");
2450 proto_tree_add_item(RDETH_header_tree, hf_infiniband_ee_context, tvb, local_offset, 3, ENC_BIG_ENDIAN);
2453 }
2455 /* Parse DETH - Datagram Extended Transport Header
2456 * IN: parentTree to add the dissection to - in this code the all_headers_tree
2457 * IN: tvb - the data buffer from wireshark
2458 * IN/OUT: The current and updated offset */
2459 static void
2461 {
2463 /* DETH - Datagram Extended Transport Header */
2467 DETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_DETH, tvb, local_offset, 8, ENC_NA);
2471 proto_tree_add_item(DETH_header_tree, hf_infiniband_queue_key, tvb, local_offset, 4, ENC_BIG_ENDIAN);
2475 proto_tree_add_item(DETH_header_tree, hf_infiniband_source_qp, tvb, local_offset, 3, ENC_BIG_ENDIAN);
2480 }
2482 /* Parse DCCETH - DC Connected Extended Transport Header
2483 * IN: parentTree to add the dissection to - in this code the all_headers_tree
2484 * IN: dctConnect - True if this is a DCT-Connect packet.
2485 * IN: tvb - the data buffer from wireshark
2486 * IN/OUT: The current and updated offset */
2487 static void
2489 {
2490 /* Do nothing just skip the header size */
2492 }
2494 /* Parse RETH - RDMA Extended Transport Header
2495 * IN: parentTree to add the dissection to - in this code the all_headers_tree
2496 * IN: tvb - the data buffer from wireshark
2497 * IN/OUT: The current and updated offset
2498 * OUT: Updated info->reth_remote_key
2499 * OUT: Updated info->reth_dma_length */
2500 static void
2503 {
2505 /* RETH - RDMA Extended Transport Header */
2509 RETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_RETH, tvb, local_offset, 16, ENC_NA);
2513 proto_tree_add_item_ret_uint64(RETH_header_tree, hf_infiniband_virtual_address, tvb, local_offset, 8, ENC_BIG_ENDIAN, &info->reth_remote_address);
2515 proto_tree_add_item_ret_uint(RETH_header_tree, hf_infiniband_remote_key, tvb, local_offset, 4, ENC_BIG_ENDIAN, &info->reth_remote_key);
2517 proto_tree_add_item_ret_uint(RETH_header_tree, hf_infiniband_dma_length, tvb, local_offset, 4, ENC_BIG_ENDIAN, &info->reth_dma_length);
2521 }
2523 /* Parse AtomicETH - Atomic Extended Transport Header
2524 * IN: parentTree to add the dissection to - in this code the all_headers_tree
2525 * IN: tvb - the data buffer from wireshark
2526 * IN/OUT: The current and updated offset */
2527 static void
2529 {
2531 /* AtomicETH - Atomic Extended Transport Header */
2535 ATOMICETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_AtomicETH, tvb, local_offset, 28, ENC_NA);
2536 proto_item_set_text(ATOMICETH_header_item, "%s", "AtomicETH - Atomic Extended Transport Header");
2539 proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_virtual_address, tvb, local_offset, 8, ENC_BIG_ENDIAN);
2541 proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_remote_key, tvb, local_offset, 4, ENC_BIG_ENDIAN);
2543 proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_swap_or_add_data, tvb, local_offset, 8, ENC_BIG_ENDIAN);
2545 proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_compare_data, tvb, local_offset, 8, ENC_BIG_ENDIAN);
2548 }
2550 /* Parse AETH - ACK Extended Transport Header
2551 * IN: parentTree to add the dissection to - in this code the all_headers_tree
2552 * IN: tvb - the data buffer from wireshark
2553 * IN/OUT: The current and updated offset */
2554 static void
2556 {
2558 /* AETH - ACK Extended Transport Header */
2566 AETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_AETH, tvb, local_offset, 4, ENC_NA);
2570 AETH_syndrome_item = proto_tree_add_item(AETH_header_tree, hf_infiniband_syndrome, tvb, local_offset, 1, ENC_BIG_ENDIAN);
2572 proto_tree_add_item(AETH_syndrome_tree, hf_infiniband_syndrome_reserved, tvb, local_offset, 1, ENC_BIG_ENDIAN);
2573 proto_tree_add_item(AETH_syndrome_tree, hf_infiniband_syndrome_opcode, tvb, local_offset, 1, ENC_BIG_ENDIAN);
2575 proto_item_append_text(AETH_syndrome_item, ", %s", val_to_str_const(opcode, aeth_syndrome_opcode_vals, "Unknown"));
2577 {
2579 proto_tree_add_item(AETH_syndrome_tree, hf_infiniband_syndrome_credit_count, tvb, local_offset, 1, ENC_BIG_ENDIAN);
2582 proto_tree_add_item(AETH_syndrome_tree, hf_infiniband_syndrome_timer, tvb, local_offset, 1, ENC_BIG_ENDIAN);
2585 proto_tree_add_item(AETH_syndrome_tree, hf_infiniband_syndrome_reserved_value, tvb, local_offset, 1, ENC_BIG_ENDIAN);
2588 proto_tree_add_item_ret_uint(AETH_syndrome_tree, hf_infiniband_syndrome_error_code, tvb, local_offset, 1, ENC_BIG_ENDIAN, &nak_error);
2589 col_append_fstr(pinfo->cinfo, COL_INFO, "[%s] ", val_to_str(nak_error, aeth_syndrome_nak_error_code_vals, "Unknown (%d)"));
2591 }
2594 proto_tree_add_item(AETH_header_tree, hf_infiniband_message_sequence_number, tvb, local_offset, 3, ENC_BIG_ENDIAN);
2598 }
2600 /* Parse AtomicAckEth - Atomic ACK Extended Transport Header
2601 * IN: parentTree to add the dissection to - in this code the all_headers_tree
2602 * IN: tvb - the data buffer from wireshark
2603 * IN/OUT: The current and updated offset */
2604 static void
2606 {
2608 /* AtomicAckEth - Atomic ACK Extended Transport Header */
2612 ATOMICACKETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_AtomicAckETH, tvb, local_offset, 8, ENC_NA);
2613 proto_item_set_text(ATOMICACKETH_header_item, "%s", "ATOMICACKETH - Atomic ACK Extended Transport Header");
2615 proto_tree_add_item(ATOMICACKETH_header_tree, hf_infiniband_original_remote_data, tvb, local_offset, 8, ENC_BIG_ENDIAN);
2618 }
2620 /* Parse IMMDT - Immediate Data Extended Transport Header
2621 * IN: parentTree to add the dissection to - in this code the all_headers_tree
2622 * IN: tvb - the data buffer from wireshark
2623 * IN/OUT: The current and updated offset */
2624 static void
2626 {
2628 /* IMMDT - Immediate Data Extended Transport Header */
2632 IMMDT_header_item = proto_tree_add_item(parentTree, hf_infiniband_IMMDT, tvb, local_offset, 4, ENC_NA);
2633 proto_item_set_text(IMMDT_header_item, "%s", "IMMDT - Immediate Data Extended Transport Header");
2638 }
2640 /* Parse IETH - Invalidate Extended Transport Header
2641 * IN: parentTree to add the dissection to - in this code the all_headers_tree
2642 * IN: tvb - the data buffer from wireshark
2643 * IN/OUT: The current and updated offset */
2644 static void
2646 {
2648 /* IETH - Invalidate Extended Transport Header */
2652 IETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_IETH, tvb, local_offset, 4, ENC_NA);
2660 }
2662 /* Parse FETH - FLUSH extended transport header
2663 * IN: parentTree to add the dissection to - in this code the all_headers_tree
2664 * IN: tvb - the data buffer from wireshark
2665 * IN/OUT: The current and updated offset */
2666 static void
2668 {
2670 /* FETH - FLUSH Extended Transport Header */
2674 FETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_FETH, tvb, local_offset, 4, ENC_NA);
2678 proto_tree_add_item(FETH_header_tree, hf_infiniband_reserved27, tvb, local_offset, 4, ENC_BIG_ENDIAN);
2680 proto_tree_add_item(FETH_header_tree, hf_infiniband_selectivity_level, tvb, local_offset, 1, ENC_BIG_ENDIAN);
2681 proto_tree_add_item(FETH_header_tree, hf_infiniband_placement_type, tvb, local_offset, 1, ENC_BIG_ENDIAN);
2685 }
2688 {
2697 conv_data = (conversation_infiniband_data *)conversation_get_proto_data(conv, proto_infiniband);
2702 }
2704 /* Parse Payload - Packet Payload / Invariant CRC / maybe Variant CRC
2705 * IN: parentTree to add the dissection to - in this code the all_headers_tree
2706 * IN: pinfo - packet info from wireshark
2707 * IN: info - infiniband info passed to subdissectors
2708 * IN: tvb - the data buffer from wireshark
2709 * IN/OUT: offset - The current and updated offset
2710 * IN: length - Length of Payload
2711 * IN: top_tree - parent tree of Infiniband dissector */
2715 {
2717 /* Payload - Packet Payload */
2724 if (!tvb_bytes_exist(tvb, *offset, length)) /* previously consumed bytes + offset was all the data - none or corrupt payload */
2725 {
2729 }
2731 /* management datagrams are determined by the source/destination QPs */
2732 if (pinfo->srcport == 0 || pinfo->srcport == 1 || pinfo->destport == 0 || pinfo->destport == 1) /* management datagram */
2733 {
2736 if (((management_class >= (uint8_t)VENDOR_1_START) && (management_class <= (uint8_t)VENDOR_1_END))
2737 || ((management_class >= (uint8_t)VENDOR_2_START) && (management_class <= (uint8_t)VENDOR_2_END)))
2738 {
2739 /* parse vendor specific */
2742 }
2743 else if ((management_class >= (uint8_t)APPLICATION_START) && (management_class <= (uint8_t)APPLICATION_END))
2744 {
2745 /* parse application specific */
2748 }
2752 {
2753 /* parse reserved classes */
2756 }
2758 {
2760 {
2762 /* parse subn man lid routed */
2766 /* parse subn directed route */
2770 /* parse sub admin */
2774 /* parse performance */
2778 /* parse baseboard mgmt */
2783 /* parse device management */
2788 /* parse communication management */
2792 /* parse snmp tunneling */
2798 }
2799 }
2800 }
2802 {
2803 /* update sport for the packet, for dissectors that performs
2804 * exact match on saddr, dadr, sport, dport tuple.
2805 */
2810 /* Calculation for Payload:
2811 * (tvb_length) Length of entire packet - (local_offset) Starting byte of Payload Data
2812 * offset addition is more complex for the payload.
2813 * We need the total length of the packet, - length of previous headers, + offset where payload started.
2814 * We also need to reserve 6 bytes for the CRCs which are not actually part of the payload. */
2821 {
2822 if (dissector_try_heuristic(heur_dissectors_payload, next_tvb, pinfo, top_tree, &hdtbl_entry, info))
2824 }
2827 {
2828 if (dissector_try_payload_with_data(subdissector_table, next_tvb, pinfo, top_tree, true, info))
2829 {
2831 }
2832 else
2833 {
2835 {
2836 if (dissector_try_heuristic(heur_dissectors_payload, next_tvb, pinfo, top_tree, &hdtbl_entry, info))
2838 }
2839 }
2840 }
2843 {
2844 /* No sub-dissector found.
2845 Label rest of packet as "Data" */
2847 }
2849 /* Will contain ICRC <and maybe VCRC> = 4 or 4+2 (crclen) */
2851 }
2854 }
2856 /* Parse VENDOR - Parse a vendor specific or unknown header sequence
2857 * IN: parentTree to add the dissection to - in this code the all_headers_tree
2858 * IN: tvb - the data buffer from wireshark
2859 * IN/OUT: The current and updated offset */
2861 {
2867 VENDOR_header_item = proto_tree_add_item(parentTree, hf_infiniband_vendor, tvb, local_offset, 4, ENC_NA);
2870 proto_tree_add_item_ret_length(VENDOR_header_tree, hf_infiniband_vendor, tvb, local_offset, -1, ENC_NA, &VENDOR_header_length);
2873 }
2875 /* Parse IPv6 - Parse an IPv6 Packet
2876 * IN: parentTree to add the dissection to - in this code the all_headers_tree
2877 * IN: tvb - the data buffer from wireshark
2878 * IN/OUT: The current and updated offset
2879 * IN: pinfo - packet info from wireshark */
2880 static void parse_IPvSix(proto_tree *parentTree, tvbuff_t *tvb, int *offset, packet_info *pinfo)
2881 {
2884 /* (- 2) for VCRC which lives at the end of the packet */
2890 /* Display the VCRC */
2892 }
2894 /* Parse EtherType - Parse a generic IP packaet with an EtherType of IP or ARP
2895 * IN: parentTree to add the dissection to - in this code the all_headers_tree
2896 * IN: tvb - the data buffer from wireshark
2897 * IN/OUT: The current and updated offset
2898 * IN: pinfo - packet info from wireshark
2899 * IN: top_tree - parent tree of Infiniband dissector */
2900 static void parse_RWH(proto_tree *ah_tree, tvbuff_t *tvb, int *offset, packet_info *pinfo, proto_tree *top_tree)
2901 {
2905 /* RWH - Raw Header */
2922 ether_type);
2925 /* Get the captured length and reported length of the data
2926 * after the Ethernet type. */
2930 /* Construct a tvbuff for the payload after the Ethernet type,
2931 * not including the FCS. */
2935 }
2943 /* Display the VCRC */
2945 }
2948 /* Parse a Mellanox EoIB Encapsulation Header and the associated Ethernet frame
2949 * IN: parentTree to add the dissection to - in this code the all_headers_tree
2950 * IN: tvb - the data buffer from wireshark
2951 * IN: The current offset
2952 * IN: pinfo - packet info from wireshark
2953 * IN: top_tree - parent tree of Infiniband dissector */
2954 static bool dissect_mellanox_eoib(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree, void *data)
2955 {
2970 /* not even large enough to contain the eoib encap header. error! */
2972 }
2983 more_segments = tvb_get_ntohs(tvb, offset) & (MELLANOX_MORE_SEGMENT_FLAG | MELLANOX_SEGMENT_FLAG);
2991 /* this is a fragment of an encapsulated Ethernet jumbo frame, parse as data */
2994 /* non-fragmented frames can be fully parsed */
2996 }
2999 }
3001 /* IBA packet data could be anything in principle, however it is common
3002 * practice to carry non-IBA data encapsulated with an EtherType header,
3003 * similar to the RWH header. There is no way to identify these frames
3004 * positively.
3005 */
3006 static bool dissect_eth_over_ib(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree, void *data)
3007 {
3015 /* not even large enough to contain the eoib encap header. error! */
3017 }
3027 /* Look for sub-dissector, and call it if found.
3028 Catch exceptions, so that if the reported length of "next_tvb"
3029 was reduced by some dissector before an exception was thrown,
3030 we can still put in an item for the trailer. */
3033 TRY {
3036 }
3037 CATCH_NONFATAL_ERRORS {
3038 /* Somebody threw an exception that means that there
3039 was a problem dissecting the payload; that means
3040 that a dissector was found, so we don't need to
3041 dissect the payload as data or update the protocol
3042 or info columns.
3044 Just show the exception and then drive on to show
3045 the trailer, after noting that a dissector was found
3046 and restoring the protocol value that was in effect
3047 before we called the subdissector.
3048 */
3053 }
3054 ENDTRY;
3060 /* now create payload entry to show Ethertype */
3063 proto_item_set_text(PAYLOAD_header_item, "%s", "IBA Payload - appears to be EtherType encapsulated");
3068 }
3071 }
3073 /* Parse Subnet Management (LID Routed)
3074 * IN: parentTree to add the dissection to
3075 * IN: pinfo - packet info from wireshark
3076 * IN: tvb - the data buffer from wireshark
3077 * IN/OUT: The current and updated offset */
3078 static void parse_SUBN_LID_ROUTED(proto_tree *parentTree, packet_info *pinfo, tvbuff_t *tvb, int *offset)
3079 {
3080 /* Parse the Common MAD Header */
3081 MAD_Data MadData;
3087 {
3088 /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
3090 }
3094 /* local_offset - 24 here because when we come out of parse_MAD_Common, the offset it sitting at the data section. */
3095 SUBN_LID_ROUTED_header_item = proto_tree_add_item(parentTree, hf_infiniband_SMP_LID, tvb, local_offset - 24, 256, ENC_NA);
3097 SUBN_LID_ROUTED_header_tree = proto_item_add_subtree(SUBN_LID_ROUTED_header_item, ett_subn_lid_routed);
3098 proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_m_key, tvb, local_offset, 8, ENC_BIG_ENDIAN);
3100 proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_reserved, tvb, local_offset, 32, ENC_NA);
3106 /* Try to do the detail parse of the attribute. If there is an error, or the attribute is unknown, we'll just highlight the generic data. */
3108 {
3109 proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_smp_data, tvb, local_offset, 64, ENC_NA);
3111 }
3113 proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_reserved, tvb, local_offset, 128, ENC_NA);
3116 }
3118 /* Parse Subnet Management (Directed Route)
3119 * IN: parentTree to add the dissection to
3120 * IN: tvb - the data buffer from wireshark
3121 * IN/OUT: The current and updated offset */
3122 static void parse_SUBN_DIRECTED_ROUTE(proto_tree *parentTree, packet_info *pinfo, tvbuff_t *tvb, int *offset)
3123 {
3124 /* Parse the Common MAD Header */
3125 MAD_Data MadData;
3131 {
3132 /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
3134 }
3138 /* local_offset - 24 here because when we come out of parse_MAD_Common, the offset it sitting at the data section.
3139 * We need to go backwards because this particular SMP uses the class specific portion of the Common MAD Header */
3140 SUBN_DIRECTED_ROUTE_header_item = proto_tree_add_item(parentTree, hf_infiniband_SMP_DIRECTED, tvb, local_offset - 24, 256, ENC_NA);
3142 SUBN_DIRECTED_ROUTE_header_tree = proto_item_add_subtree(SUBN_DIRECTED_ROUTE_header_item, ett_subn_directed_route);
3147 /* Place us at offset 4, the "D" Bit (Direction bit for Directed Route SMPs) */
3149 proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_d, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3150 proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_smp_status, tvb, local_offset, 2, ENC_BIG_ENDIAN);
3152 proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_hop_pointer, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3154 proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_hop_count, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3156 local_offset += 16; /* Skip over the rest of the Common MAD Header... It's already dissected by parse_MAD_Common */
3157 proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_m_key, tvb, local_offset, 8, ENC_BIG_ENDIAN);
3159 proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_dr_slid, tvb, local_offset, 2, ENC_BIG_ENDIAN);
3161 proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_dr_dlid, tvb, local_offset, 2, ENC_BIG_ENDIAN);
3163 proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_reserved, tvb, local_offset, 28, ENC_NA);
3166 /* Try to do the detail parse of the attribute. If there is an error, or the attribute is unknown, we'll just highlight the generic data. */
3168 {
3169 proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_smp_data, tvb, local_offset, 64, ENC_NA);
3171 }
3173 proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_initial_path, tvb, local_offset, 64, ENC_NA);
3175 proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_return_path, tvb, local_offset, 64, ENC_NA);
3178 }
3180 /* Parse Subnet Administration
3181 * IN: parentTree to add the dissection to
3182 * IN: pinfo - packet info from wireshark
3183 * IN: tvb - the data buffer from wireshark
3184 * IN/OUT: The current and updated offset */
3185 static void parse_SUBNADMN(proto_tree *parentTree, packet_info *pinfo, tvbuff_t *tvb, int *offset)
3186 {
3187 /* Parse the Common MAD Header */
3188 MAD_Data MadData;
3194 {
3195 /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
3197 }
3199 {
3200 /* TODO: Mark Corrupt Packet */
3202 }
3205 SUBNADMN_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset - 36, 256, ENC_NA);
3209 proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_sm_key, tvb, local_offset, 8, ENC_BIG_ENDIAN);
3211 proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_attribute_offset, tvb, local_offset, 2, ENC_BIG_ENDIAN);
3213 proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_reserved, tvb, local_offset, 2, ENC_NA);
3215 proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_component_mask, tvb, local_offset, 8, ENC_BIG_ENDIAN);
3222 {
3223 proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_subnet_admin_data, tvb, local_offset, 200, ENC_NA);
3225 }
3227 }
3229 /* Parse Performance Management
3230 * IN: parentTree to add the dissection to
3231 * IN: tvb - the data buffer from wireshark
3232 * IN: pinfo - the pinfo struct from wireshark
3233 * IN/OUT: The current and updated offset */
3235 {
3236 /* Parse the Common MAD Header */
3237 MAD_Data MadData;
3242 {
3243 /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
3245 }
3252 proto_tree_add_item(parentTree, hf_infiniband_PerfMgt_ClassPortInfo, tvb, local_offset, 40, ENC_NA);
3265 PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, MAD_DATA_SIZE, ENC_NA);
3267 proto_item_set_text(PERF_header_item, "%s", "PERF - Performance Management MAD (Dissector Not Implemented)");
3269 }
3272 }
3274 /* Parse Baseboard Management
3275 * IN: parentTree to add the dissection to
3276 * IN: tvb - the data buffer from wireshark
3277 * IN/OUT: The current and updated offset */
3279 {
3280 /* Parse the Common MAD Header */
3281 MAD_Data MadData;
3286 {
3287 /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
3289 }
3292 BM_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, MAD_DATA_SIZE, ENC_NA);
3294 proto_item_set_text(BM_header_item, "%s", "BM - Baseboard Management MAD (Dissector Not Implemented)");
3296 }
3298 /* Parse Device Management
3299 * IN: parentTree to add the dissection to
3300 * IN: tvb - the data buffer from wireshark
3301 * IN/OUT: The current and updated offset */
3303 {
3304 /* Parse the Common MAD Header */
3305 MAD_Data MadData;
3310 {
3311 /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
3313 }
3315 DEVM_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, MAD_DATA_SIZE, ENC_NA);
3317 proto_item_set_text(DEVM_header_item, "%s", "DEV_MGT - Device Management MAD (Dissector Not Implemented)");
3319 }
3321 static bool parse_CM_Req_ServiceID(proto_tree *parent_tree, tvbuff_t *tvb, int *offset, uint64_t serviceid)
3322 {
3329 service_id_item = proto_tree_add_item(parent_tree, hf_cm_req_service_id, tvb, local_offset, 8, ENC_NA);
3333 proto_tree_add_item(service_id_tree, hf_cm_req_service_id_prefix, tvb, local_offset, 5, ENC_NA);
3335 proto_tree_add_item(service_id_tree, hf_cm_req_service_id_protocol, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3337 proto_tree_add_item(service_id_tree, hf_cm_req_service_id_dport, tvb, local_offset, 2, ENC_BIG_ENDIAN);
3344 }
3347 }
3350 {
3356 }
3359 {
3367 }
3370 {
3376 }
3378 static void
3384 {
3397 /* next, register the conversation using the LIDs */
3402 }
3404 static void save_conversation_info(packet_info *pinfo, uint8_t *local_gid, uint8_t *remote_gid,
3407 {
3408 /* the following saves information about the conversation this packet defines,
3409 so there's no point in doing it more than once per packet */
3411 {
3417 /* create a new connection context and store it in the hash table */
3426 }
3433 /* save the context to the context hash table, for retrieval when the corresponding
3434 CM REP message arrives */
3438 /* Now we create a conversation for the CM exchange. This uses both
3439 sides of the conversation since CM packets also include the source
3440 QPN */
3449 /* create unidirection conversation for packets that will flow from
3450 * server to client.
3451 */
3456 }
3457 }
3460 {
3465 private_data_item = proto_tree_add_item(parent_tree, hf_cm_req_ip_cm_req_msg, tvb, local_offset, 92, ENC_NA);
3469 proto_tree_add_item(private_data_tree, hf_cm_req_ip_cm_majv, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3470 proto_tree_add_item(private_data_tree, hf_cm_req_ip_cm_minv, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3475 proto_tree_add_item(private_data_tree, hf_cm_req_ip_cm_ipv, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3476 proto_tree_add_item(private_data_tree, hf_cm_req_ip_cm_res, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3478 proto_tree_add_item(private_data_tree, hf_cm_req_ip_cm_sport, tvb, local_offset, 2, ENC_BIG_ENDIAN);
3482 /* skip first 12 bytes of zero for sip */
3483 proto_tree_add_item(private_data_tree, hf_cm_req_ip_cm_sip4, tvb, local_offset + 12, 4, ENC_NA);
3485 /* skip first 12 bytes of zero for dip */
3486 proto_tree_add_item(private_data_tree, hf_cm_req_ip_cm_dip4, tvb, local_offset + 12, 4, ENC_NA);
3491 }
3494 /* finally add the consumer specific private data as undecoded data */
3497 }
3501 {
3514 proto_tree_add_item(CM_header_tree, hf_cm_req_local_comm_id, tvb, local_offset, 4, ENC_BIG_ENDIAN);
3522 proto_tree_add_item(CM_header_tree, hf_cm_req_local_ca_guid, tvb, local_offset, 8, ENC_BIG_ENDIAN);
3526 proto_tree_add_item(CM_header_tree, hf_cm_req_local_qkey, tvb, local_offset, 4, ENC_BIG_ENDIAN);
3528 proto_tree_add_item(CM_header_tree, hf_cm_req_local_qpn, tvb, local_offset, 3, ENC_BIG_ENDIAN);
3531 proto_tree_add_item(CM_header_tree, hf_cm_req_respo_res, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3533 proto_tree_add_item(CM_header_tree, hf_cm_req_local_eecn, tvb, local_offset, 3, ENC_BIG_ENDIAN);
3535 proto_tree_add_item(CM_header_tree, hf_cm_req_init_depth, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3537 proto_tree_add_item(CM_header_tree, hf_cm_req_remote_eecn, tvb, local_offset, 3, ENC_BIG_ENDIAN);
3539 proto_tree_add_item(CM_header_tree, hf_cm_req_remote_cm_resp_to, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3540 proto_tree_add_item(CM_header_tree, hf_cm_req_transp_serv_type, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3541 proto_tree_add_item(CM_header_tree, hf_cm_req_e2e_flow_ctrl, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3543 proto_tree_add_item(CM_header_tree, hf_cm_req_start_psn, tvb, local_offset, 3, ENC_BIG_ENDIAN);
3545 proto_tree_add_item(CM_header_tree, hf_cm_req_local_cm_resp_to, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3546 proto_tree_add_item(CM_header_tree, hf_cm_req_retry_count, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3550 proto_tree_add_item(CM_header_tree, hf_cm_req_path_pp_mtu, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3551 proto_tree_add_item(CM_header_tree, hf_cm_req_rdc_exists, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3552 proto_tree_add_item(CM_header_tree, hf_cm_req_rnr_retry_count, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3554 proto_tree_add_item(CM_header_tree, hf_cm_req_max_cm_retries, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3556 proto_tree_add_item(CM_header_tree, hf_cm_req_extended_transport, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3558 proto_tree_add_item(CM_header_tree, hf_cm_req_primary_local_lid, tvb, local_offset, 2, ENC_BIG_ENDIAN);
3561 proto_tree_add_item(CM_header_tree, hf_cm_req_primary_remote_lid, tvb, local_offset, 2, ENC_BIG_ENDIAN);
3567 proto_tree_add_item(CM_header_tree, hf_cm_req_primary_local_gid_ipv4, tvb, local_offset + 12, 4, ENC_NA);
3572 proto_tree_add_item(CM_header_tree, hf_cm_req_primary_remote_gid_ipv4, tvb, local_offset + 12, 4, ENC_NA);
3576 proto_tree_add_item(CM_header_tree, hf_cm_req_primary_local_gid, tvb, local_offset, 16, ENC_NA);
3581 proto_tree_add_item(CM_header_tree, hf_cm_req_primary_remote_gid, tvb, local_offset, 16, ENC_NA);
3583 }
3586 proto_tree_add_item(CM_header_tree, hf_cm_req_primary_flow_label, tvb, local_offset, 3, ENC_BIG_ENDIAN);
3588 proto_tree_add_item(CM_header_tree, hf_cm_req_primary_reserved0, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3590 proto_tree_add_item(CM_header_tree, hf_cm_req_primary_packet_rate, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3592 proto_tree_add_item(CM_header_tree, hf_cm_req_primary_traffic_class, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3594 proto_tree_add_item(CM_header_tree, hf_cm_req_primary_hop_limit, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3596 proto_tree_add_item(CM_header_tree, hf_cm_req_primary_sl, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3597 proto_tree_add_item(CM_header_tree, hf_cm_req_primary_subnet_local, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3598 proto_tree_add_item(CM_header_tree, hf_cm_req_primary_reserved1, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3600 proto_tree_add_item(CM_header_tree, hf_cm_req_primary_local_ack_to, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3601 proto_tree_add_item(CM_header_tree, hf_cm_req_primary_reserved2, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3603 proto_tree_add_item(CM_header_tree, hf_cm_req_alt_local_lid, tvb, local_offset, 2, ENC_BIG_ENDIAN);
3605 proto_tree_add_item(CM_header_tree, hf_cm_req_alt_remote_lid, tvb, local_offset, 2, ENC_BIG_ENDIAN);
3611 proto_tree_add_item(CM_header_tree, hf_cm_req_flow_label, tvb, local_offset, 3, ENC_BIG_ENDIAN);
3613 proto_tree_add_item(CM_header_tree, hf_cm_req_alt_reserved0, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3615 proto_tree_add_item(CM_header_tree, hf_cm_req_packet_rate, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3617 proto_tree_add_item(CM_header_tree, hf_cm_req_alt_traffic_class, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3619 proto_tree_add_item(CM_header_tree, hf_cm_req_alt_hop_limit, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3622 proto_tree_add_item(CM_header_tree, hf_cm_req_subnet_local, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3623 proto_tree_add_item(CM_header_tree, hf_cm_req_alt_reserved1, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3625 proto_tree_add_item(CM_header_tree, hf_cm_req_local_ACK_timeout, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3626 proto_tree_add_item(CM_header_tree, hf_cm_req_alt_reserved2, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3629 save_conversation_info(pinfo, local_gid, remote_gid, local_qpn, local_lid, remote_lid, serviceid, MadData);
3632 /* decode IP CM service specific private data */
3634 /* ip_cm.req is 36 in length */
3637 /* Add the undecoded private data anyway as RDMA CM private data */
3640 }
3642 /* give a chance for subdissectors to analyze the private data */
3643 dissector_try_heuristic(heur_dissectors_cm_private, next_tvb, pinfo, top_tree, &hdtbl_entry, info);
3647 }
3650 {
3662 }
3664 static void
3667 {
3668 address req_addr,
3671 /* RC traffic never(?) includes a field indicating the source QPN, so
3672 the destination host knows it only from previous context (a single
3673 QPN on the host that is part of an RC can only receive traffic from
3674 that RC). For this reason we do not register conversations with both
3675 sides, but rather we register the same conversation twice - once for
3676 each side of the Reliable Connection. */
3687 }
3689 /* create conversations:
3690 * first for client to server direction so that upper level protocols
3691 * can do appropriate dissection depending on the message direction.
3692 */
3697 /* now create bidirectional connection that can be looked upon
3698 * by ULP for stateful context in both directions.
3699 */
3701 }
3705 {
3715 conv_data = (conversation_infiniband_data *)conversation_get_proto_data(conv, proto_infiniband);
3719 }
3724 {
3725 /* the following saves information about the conversation this packet defines,
3726 so there's no point in doing it more than once per packet */
3728 /* get the previously saved context for this connection */
3733 /* if an appropriate connection was not found there's something wrong, but nothing we can
3734 do about it here - so just skip saving the context */
3739 }
3740 }
3741 }
3745 {
3753 proto_tree_add_item(CM_header_tree, hf_cm_rep_localcommid, tvb, local_offset, 4, ENC_BIG_ENDIAN);
3755 proto_tree_add_item(CM_header_tree, hf_cm_rep_remotecommid, tvb, local_offset, 4, ENC_BIG_ENDIAN);
3757 proto_tree_add_item(CM_header_tree, hf_cm_rep_localqkey, tvb, local_offset, 4, ENC_BIG_ENDIAN);
3764 proto_tree_add_item(CM_header_tree, hf_cm_rep_localeecontnum, tvb, local_offset, 3, ENC_BIG_ENDIAN);
3768 proto_tree_add_item(CM_header_tree, hf_cm_rep_startingpsn, tvb, local_offset, 3, ENC_BIG_ENDIAN);
3772 proto_tree_add_item(CM_header_tree, hf_cm_rep_responderres, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3774 proto_tree_add_item(CM_header_tree, hf_cm_rep_initiatordepth, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3776 proto_tree_add_item(CM_header_tree, hf_cm_rep_tgtackdelay, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3777 proto_tree_add_item(CM_header_tree, hf_cm_rep_failoveracc, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3778 proto_tree_add_item(CM_header_tree, hf_cm_rep_e2eflowctl, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3780 proto_tree_add_item(CM_header_tree, hf_cm_rep_rnrretrycount, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3784 proto_tree_add_item(CM_header_tree, hf_cm_rep_localcaguid, tvb, local_offset, 8, ENC_BIG_ENDIAN);
3790 /* give a chance for subdissectors to get the private data */
3792 dissector_try_heuristic(heur_dissectors_cm_private, next_tvb, pinfo, top_tree, &hdtbl_entry, info);
3796 }
3802 {
3813 }
3818 {
3822 proto_tree_add_item(CM_header_tree, hf_cm_rtu_localcommid, tvb, local_offset, 4, ENC_BIG_ENDIAN);
3824 proto_tree_add_item(CM_header_tree, hf_cm_rtu_remotecommid, tvb, local_offset, 4, ENC_BIG_ENDIAN);
3827 try_connection_dissectors(top_tree, pinfo, tvb, &pinfo->src, MadData, info, local_offset, 224);
3830 }
3835 {
3839 proto_tree_add_item(CM_header_tree, hf_cm_rej_local_commid, tvb, local_offset, 4, ENC_BIG_ENDIAN);
3841 proto_tree_add_item(CM_header_tree, hf_cm_rej_remote_commid, tvb, local_offset, 4, ENC_BIG_ENDIAN);
3844 proto_tree_add_item(CM_header_tree, hf_cm_rej_msg_reserved0, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3846 proto_tree_add_item(CM_header_tree, hf_cm_rej_rej_info_len, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3847 proto_tree_add_item(CM_header_tree, hf_cm_rej_msg_reserved1, tvb, local_offset, 1, ENC_BIG_ENDIAN);
3855 try_connection_dissectors(top_tree, pinfo, tvb, &pinfo->dst, MadData, info, local_offset, 148);
3858 }
3860 static void parse_CM_DReq(proto_tree *top_tree, packet_info *pinfo, tvbuff_t *tvb, int *offset,
3863 {
3867 proto_tree_add_item(CM_header_tree, hf_cm_dreq_localcommid, tvb, local_offset, 4, ENC_BIG_ENDIAN);
3869 proto_tree_add_item(CM_header_tree, hf_cm_dreq_remotecommid, tvb, local_offset, 4, ENC_BIG_ENDIAN);
3871 proto_tree_add_item(CM_header_tree, hf_cm_dreq_remote_qpn, tvb, local_offset, 3, ENC_BIG_ENDIAN);
3876 try_connection_dissectors(top_tree, pinfo, tvb, &pinfo->src, MadData, info, local_offset, 220);
3879 }
3881 static void parse_CM_DRsp(proto_tree *top_tree, packet_info *pinfo, tvbuff_t *tvb, int *offset,
3884 {
3889 proto_tree_add_item(CM_header_tree, hf_cm_drsp_localcommid, tvb, local_offset, 4, ENC_BIG_ENDIAN);
3891 proto_tree_add_item(CM_header_tree, hf_cm_drsp_remotecommid, tvb, local_offset, 4, ENC_BIG_ENDIAN);
3895 /* connection is closing so remove entry from the connection table */
3896 connection = try_connection_dissectors(top_tree, pinfo, tvb, &pinfo->dst, MadData, info, local_offset, 224);
3902 }
3904 /* Parse Communication Management
3905 * IN: parentTree to add the dissection to
3906 * IN: tvb - the data buffer from wireshark
3907 * IN/OUT: The current and updated offset */
3908 static void parse_COM_MGT(proto_tree *parentTree, packet_info *pinfo, tvbuff_t *tvb, int *offset, proto_tree* top_tree)
3909 {
3910 MAD_Data MadData;
3918 {
3919 /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
3921 }
3924 CM_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, MAD_DATA_SIZE, ENC_NA);
3963 }
3966 }
3968 /* Parse SNMP Tunneling
3969 * IN: parentTree to add the dissection to
3970 * IN: tvb - the data buffer from wireshark
3971 * IN/OUT: The current and updated offset */
3973 {
3974 /* Parse the Common MAD Header */
3975 MAD_Data MadData;
3980 {
3981 /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
3983 }
3986 SNMP_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, MAD_DATA_SIZE, ENC_NA);
3988 proto_item_set_text(SNMP_header_item, "%s", "SNMP - SNMP Tunneling MAD (Dissector Not Implemented)");
3990 }
3992 /* Parse Vendor Specific Management Packets
3993 * IN: parentTree to add the dissection to
3994 * IN: tvb - the data buffer from wireshark
3995 * IN/OUT: The current and updated offset */
3997 {
3998 /* Parse the Common MAD Header */
3999 MAD_Data MadData;
4004 {
4005 /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
4007 }
4010 VENDOR_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, MAD_DATA_SIZE, ENC_NA);
4012 proto_item_set_text(VENDOR_header_item, "%s", "VENDOR - Vendor Specific Management MAD (Dissector Not Implemented)");
4014 }
4016 /* Parse Application Specific Management Packets
4017 * IN: parentTree to add the dissection to
4018 * IN: tvb - the data buffer from wireshark
4019 * IN/OUT: The current and updated offset */
4021 {
4022 /* Parse the Common MAD Header */
4023 MAD_Data MadData;
4028 {
4029 /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
4031 }
4033 APP_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, MAD_DATA_SIZE, ENC_NA);
4035 proto_item_set_text(APP_header_item, "%s", "APP - Application Specific MAD (Dissector Not Implemented)");
4037 }
4039 /* Parse Reserved Management Packets.
4041 * This is an !ERROR CONDITION!
4042 * It means that the Management Class value used was defined as a reserved value for furture use.
4043 * This method is here since we will want to report this information directly to the UI without blowing up Wireshark.
4045 * IN: parentTree to add the dissection to
4046 * IN: tvb - the data buffer from wireshark
4047 * IN/OUT: The current and updated offset */
4049 {
4050 /* Parse the Common MAD Header */
4051 MAD_Data MadData;
4056 {
4057 /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
4059 }
4061 RESV_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, ENC_NA);
4063 proto_item_set_text(RESV_header_item, "%s", "RESERVED - Reserved MAD Type (Possible Device Error)");
4065 }
4067 /* Parse the common MAD Header
4068 * IN: parentTree to add the dissection to
4069 * IN: tvb - the data buffer from wireshark
4070 * IN/OUT: The current and updated offset
4071 * IN/OUT: MadData - the data from the MAD header */
4072 static bool parse_MAD_Common(proto_tree *parentTree, tvbuff_t *tvb, int *offset, MAD_Data* MadData)
4073 {
4083 /* Get the Management Class to decide between LID Routed and Direct Route */
4094 /* Populate the Dissector Tree */
4096 MAD_header_item = proto_tree_add_item(parentTree, hf_infiniband_MAD, tvb, local_offset, 256, ENC_NA);
4100 proto_tree_add_item(MAD_header_tree, hf_infiniband_base_version, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4102 proto_tree_add_item(MAD_header_tree, hf_infiniband_mgmt_class, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4104 proto_tree_add_item(MAD_header_tree, hf_infiniband_class_version, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4106 proto_tree_add_item(MAD_header_tree, hf_infiniband_method, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4108 proto_tree_add_item(MAD_header_tree, hf_infiniband_status, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4110 proto_tree_add_item(MAD_header_tree, hf_infiniband_class_specific, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4112 proto_tree_add_item(MAD_header_tree, hf_infiniband_transaction_id, tvb, local_offset, 8, ENC_BIG_ENDIAN);
4114 proto_tree_add_item(MAD_header_tree, hf_infiniband_attribute_id, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4118 proto_tree_add_item(MAD_header_tree, hf_infiniband_attribute_modifier, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4120 proto_tree_add_item(MAD_header_tree, hf_infiniband_data, tvb, local_offset, MAD_DATA_SIZE, ENC_NA);
4121 *offset = local_offset; /* Move the offset to the start of the Data field - this will be where the other parsers start. */
4124 }
4126 /* Parse the RMPP (Reliable Multi-Packet Transaction Protocol
4127 * IN: parentTree to add the dissection to
4128 * IN: tvb - the data buffer from wireshark
4129 * IN/OUT: The current and updated offset */
4131 {
4137 RMPP_header_item = proto_tree_add_item(parentTree, hf_infiniband_RMPP, tvb, local_offset, 12, ENC_NA);
4138 proto_item_set_text(RMPP_header_item, "%s", val_to_str(RMPP_Type, RMPP_Packet_Types, "Reserved RMPP Type! (0x%02x)"));
4141 proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_version, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4143 proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_type, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4145 proto_tree_add_item(RMPP_header_tree, hf_infiniband_r_resp_time, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4146 proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_flags, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4148 proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_status, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4151 {
4153 proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_data1, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4155 proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_data2, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4159 proto_tree_add_item(RMPP_header_tree, hf_infiniband_segment_number, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4161 proto_tree_add_item(RMPP_header_tree, hf_infiniband_payload_length32, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4163 proto_tree_add_item(RMPP_header_tree, hf_infiniband_transferred_data, tvb, local_offset, 220, ENC_NA);
4166 proto_tree_add_item(RMPP_header_tree, hf_infiniband_segment_number, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4168 proto_tree_add_item(RMPP_header_tree, hf_infiniband_new_window_last, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4178 proto_tree_add_item(RMPP_header_tree, hf_infiniband_optional_extended_error_data, tvb, local_offset, 220, ENC_NA);
4182 }
4185 }
4187 /* Parse the Method from the MAD Common Header.
4188 * Simply used to generate the identifier.
4189 * IN: SubMItem - the item to append the method label to.
4190 * IN: MadHeader - the MadData structure that contains the information from the Common MAD header.
4191 * IN: pinfo - packet info from wireshark. */
4193 {
4194 const char *label = val_to_str_const(MadHeader->method, SUBM_Methods, "(Unknown SubManagement Method!)");
4198 }
4200 /* Parse the SA Method from the MAD Common Header.
4201 * Simply used to generate the identifier.
4202 * IN: SubAItem - the item to append the method label to.
4203 * IN: MadHeader - the MadData structure that contains the information from the Common MAD header.
4204 * IN: pinfo - packet info from wireshark. */
4206 {
4207 const char *label = val_to_str_const(MadHeader->method, SUBA_Methods, "(Unknown SubAdministration Method!)");
4211 }
4213 /* Parse the Attribute from the MAD Common Header
4214 * Simply used to generate the identifier.
4215 * IN: SubMItem - the item to append the Attribute label to.
4216 * IN: MadHeader - the MadData structure that contains the information from the Common MAD header.
4217 * IN: pinfo - packet info from wireshark. */
4218 static void label_SUBM_Attribute(proto_item *SubMItem, MAD_Data *MadHeader, packet_info *pinfo)
4219 {
4220 const char *label = val_to_str_const(MadHeader->attributeID, SUBM_Attributes, "(Unknown SubManagement Attribute!)");
4224 }
4226 /* Parse the SA Attribute from the MAD Common Header
4227 * Simply used to generate the identifier.
4228 * IN: SubAItem - the item to append the Attribute label to.
4229 * IN: MadHeader - the MadData structure that contains the information from the Common MAD header.
4230 * IN: pinfo - packet info from wireshark. */
4231 static void label_SUBA_Attribute(proto_item *SubAItem, MAD_Data *MadHeader, packet_info *pinfo)
4232 {
4233 const char *label = val_to_str_const(MadHeader->attributeID, SUBA_Attributes, "(Unknown SubAdministration Attribute!)");
4237 }
4239 /* Parse the attribute from a Subnet Management Packet.
4240 * IN: Parent Tree to add the item to in the dissection tree
4241 * IN: tvbuff, offset - the data and where it is.
4242 * IN: MAD_Data the data from the Common MAD Header that provides the information we need */
4243 static bool parse_SUBM_Attribute(proto_tree *parentTree, tvbuff_t *tvb, int *offset, MAD_Data *MadHeader)
4244 {
4249 SUBM_Attribute_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, *offset, 64, ENC_NA);
4250 proto_item_set_text(SUBM_Attribute_header_item, "%s", val_to_str(attributeID, SUBM_Attributes, "Unknown Attribute Type! (0x%02x)"));
4251 SUBM_Attribute_header_tree = proto_item_add_subtree(SUBM_Attribute_header_item, ett_subm_attribute);
4255 {
4306 }
4312 }
4313 /* Parse the attribute from a Subnet Administration Packet.
4314 * IN: Parent Tree to add the item to in the dissection tree
4315 * IN: tvbuff, offset - the data and where it is.
4316 * IN: MAD_Data the data from the Common MAD Header that provides the information we need */
4317 static bool parse_SUBA_Attribute(proto_tree *parentTree, tvbuff_t *tvb, int *offset, MAD_Data *MadHeader)
4318 {
4323 SUBA_Attribute_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, *offset, 200, ENC_NA);
4324 proto_item_set_text(SUBA_Attribute_header_item, "%s", val_to_str(attributeID, SUBA_Attributes, "Unknown Attribute Type! (0x%02x)"));
4325 SUBA_Attribute_header_tree = proto_item_add_subtree(SUBA_Attribute_header_item, ett_suba_attribute);
4327 /* Skim off the RID fields should they be present */
4330 /* Parse the rest of the attributes */
4332 {
4405 /* We've already labeled as unknown in item construction */
4407 }
4411 }
4413 /* Subnet Management Attribute Parsing Methods.
4414 * Also Parsing for Attributes common to both SM/SA.
4415 * The Subnet Admin Parsing methods will call some of these methods when an attribute is present within an SA MAD
4416 */
4419 /* Parse ClassPortInfo Attribute Field
4420 * IN: parentTree - The tree to add the dissection to
4421 * tvb - The tvbbuff of packet data
4422 * offset - The offset in TVB where the attribute begins */
4424 {
4433 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_BaseVersion, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4435 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_ClassVersion, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4437 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_CapabilityMask, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4439 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_CapabilityMask2, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4442 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_RespTimeValue, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4444 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_RedirectGID, tvb, local_offset, 16, ENC_NA);
4446 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_RedirectTC, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4448 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_RedirectSL, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4449 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_RedirectFL, tvb, local_offset, 3, ENC_BIG_ENDIAN);
4451 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_RedirectLID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4453 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_RedirectP_Key, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4455 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_Reserved, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4457 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_RedirectQP, tvb, local_offset, 3, ENC_BIG_ENDIAN);
4459 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_RedirectQ_Key, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4462 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_TrapGID, tvb, local_offset, 16, ENC_NA);
4464 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_TrapTC, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4466 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_TrapSL, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4467 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_TrapFL, tvb, local_offset, 3, ENC_BIG_ENDIAN);
4469 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_TrapLID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4471 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_TrapP_Key, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4473 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_Reserved, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4475 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_TrapQP, tvb, local_offset, 3, ENC_BIG_ENDIAN);
4477 proto_tree_add_item(ClassPortInfo_header_tree, hf_infiniband_ClassPortInfo_TrapQ_Key, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4481 }
4483 /* Parse NoticeDataDetails Attribute Field
4484 * IN: parentTree - The tree to add the dissection to
4485 * tvb - The tvbbuff of packet data
4486 * offset - The offset in TVB where the attribute begins
4487 * trapNumber - The Trap ID of the Trap Data being Dissected */
4489 static int parse_NoticeDataDetails(proto_tree* parentTree, tvbuff_t* tvb, int *offset, uint16_t trapNumber)
4490 {
4498 DataDetails_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 54, ENC_NA);
4503 {
4507 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR, tvb, local_offset, 16, ENC_NA);
4513 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR, tvb, local_offset, 16, ENC_NA);
4519 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR, tvb, local_offset, 16, ENC_NA);
4525 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR, tvb, local_offset, 16, ENC_NA);
4530 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_COMP_MASK, tvb, local_offset, 8, ENC_BIG_ENDIAN);
4532 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_WAIT_FOR_REPATH, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4536 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_COMP_MASK, tvb, local_offset, 8, ENC_BIG_ENDIAN);
4538 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_WAIT_FOR_REPATH, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4542 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4548 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4550 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4556 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4558 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4564 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4566 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4572 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4575 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_OtherLocalChanges, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4577 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_CAPABILITYMASK, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4580 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LinkSpeecEnabledChange, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4581 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LinkWidthEnabledChange, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4582 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_NodeDescriptionChange, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4587 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4590 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SYSTEMIMAGEGUID, tvb, local_offset, 8, ENC_BIG_ENDIAN);
4596 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4598 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRSLID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4600 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_METHOD, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4603 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_ATTRIBUTEID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4605 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_ATTRIBUTEMODIFIER, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4607 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_MKEY, tvb, local_offset, 8, ENC_BIG_ENDIAN);
4610 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRNotice, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4611 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRPathTruncated, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4612 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRHopCount, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4614 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRNoticeReturnPath, tvb, local_offset, 30, ENC_NA);
4620 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR1, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4622 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR2, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4624 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_KEY, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4626 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SL, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4628 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP1, tvb, local_offset, 3, ENC_BIG_ENDIAN);
4631 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP2, tvb, local_offset, 3, ENC_BIG_ENDIAN);
4633 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR1, tvb, local_offset, 16, ENC_NA);
4635 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR2, tvb, local_offset, 16, ENC_NA);
4641 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR1, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4643 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR2, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4645 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_KEY, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4647 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SL, tvb, local_offset, 1, ENC_BIG_ENDIAN); local_offset += 1;
4648 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP1, tvb, local_offset, 3, ENC_BIG_ENDIAN);
4651 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP2, tvb, local_offset, 3, ENC_BIG_ENDIAN);
4653 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR1, tvb, local_offset, 16, ENC_NA);
4655 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR2, tvb, local_offset, 16, ENC_NA);
4660 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DataValid, tvb, local_offset, 2, ENC_NA);
4662 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR1, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4664 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR2, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4666 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PKEY, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4668 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SL, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4670 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP1, tvb, local_offset, 3, ENC_BIG_ENDIAN);
4673 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP2, tvb, local_offset, 3, ENC_BIG_ENDIAN);
4675 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR1, tvb, local_offset, 16, ENC_NA);
4677 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR2, tvb, local_offset, 16, ENC_NA);
4679 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SWLIDADDR, tvb, local_offset, 2, ENC_NA);
4681 proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4688 }
4691 }
4693 /* Parse NoticesAndTraps Attribute
4694 * IN: parentTree - The tree to add the dissection to
4695 * tvb - The tvbbuff of packet data
4696 * offset - The offset in TVB where the attribute begins */
4698 {
4707 NoticesAndTraps_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, ENC_NA);
4708 proto_item_set_text(NoticesAndTraps_header_item, "%s", val_to_str(trapNumber, Trap_Description, "Unknown or Vendor Specific Trap Number! (0x%02x)"));
4709 NoticesAndTraps_header_tree = proto_item_add_subtree(NoticesAndTraps_header_item, ett_noticestraps);
4711 proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_IsGeneric, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4712 proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_Type, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4714 proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_ProducerTypeVendorID, tvb, local_offset, 3, ENC_BIG_ENDIAN);
4716 proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_TrapNumberDeviceID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4718 proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_IssuerLID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4720 proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_NoticeToggle, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4721 proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_NoticeCount, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4725 proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_DataDetails, tvb, local_offset, 54, ENC_NA);
4729 *proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_IssuerGID, tvb, local_offset, 16, ENC_NA);
4731 *proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_ClassTrapSpecificData, tvb, local_offset, 1, ENC_NA);
4733 #endif
4735 }
4737 /* Parse NodeDescription Attribute
4738 * IN: parentTree - The tree to add the dissection to
4739 * tvb - The tvbbuff of packet data
4740 * offset - The offset in TVB where the attribute begins */
4742 {
4750 proto_tree_add_item(NodeDescription_header_tree, hf_infiniband_NodeDescription_NodeString, tvb, local_offset, 64, ENC_ASCII);
4751 }
4753 /* Parse NodeInfo Attribute
4754 * IN: parentTree - The tree to add the dissection to
4755 * tvb - The tvbbuff of packet data
4756 * offset - The offset in TVB where the attribute begins */
4758 {
4767 proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_BaseVersion, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4769 proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_ClassVersion, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4771 proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_NodeType, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4773 proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_NumPorts, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4775 proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_SystemImageGUID, tvb, local_offset, 8, ENC_BIG_ENDIAN);
4777 proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_NodeGUID, tvb, local_offset, 8, ENC_BIG_ENDIAN);
4779 proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_PortGUID, tvb, local_offset, 8, ENC_BIG_ENDIAN);
4781 proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_PartitionCap, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4783 proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_DeviceID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4785 proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_Revision, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4787 proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_LocalPortNum, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4789 proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_VendorID, tvb, local_offset, 3, ENC_BIG_ENDIAN);
4794 }
4796 /* Parse SwitchInfo Attribute
4797 * IN: parentTree - The tree to add the dissection to
4798 * tvb - The tvbbuff of packet data
4799 * offset - The offset in TVB where the attribute begins */
4801 {
4810 proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LinearFDBCap, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4812 proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_RandomFDBCap, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4814 proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_MulticastFDBCap, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4816 proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LinearFDBTop, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4818 proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_DefaultPort, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4820 proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4822 proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4824 proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LifeTimeValue, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4825 proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_PortStateChange, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4826 proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4828 proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LIDsPerPort, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4830 proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_PartitionEnforcementCap, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4832 proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_InboundEnforcementCap, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4833 proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_OutboundEnforcementCap, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4834 proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_FilterRawInboundCap, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4835 proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_FilterRawOutboundCap, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4836 proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_EnhancedPortZero, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4840 }
4842 /* Parse GUIDInfo Attribute
4843 * IN: parentTree - The tree to add the dissection to
4844 * tvb - The tvbbuff of packet data
4845 * offset - The offset in TVB where the attribute begins */
4847 {
4859 {
4860 tempItemLow = proto_tree_add_item(GUIDInfo_header_tree, hf_infiniband_GUIDInfo_GUID, tvb, local_offset, 8, ENC_BIG_ENDIAN);
4863 }
4865 }
4867 /* Parse PortInfo Attribute
4868 * IN: parentTree - The tree to add the dissection to
4869 * tvb - The tvbbuff of packet data
4870 * offset - The offset in TVB where the attribute begins */
4872 {
4885 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_Key, tvb, local_offset, 8, ENC_BIG_ENDIAN);
4887 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_GidPrefix, tvb, local_offset, 8, ENC_BIG_ENDIAN);
4889 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4891 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MasterSMLID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4894 /* Capability Mask Flags */
4895 PortInfo_CapabilityMask_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_CapabilityMask, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4896 PortInfo_CapabilityMask_tree = proto_item_add_subtree(PortInfo_CapabilityMask_item, ett_portinfo_capmask);
4898 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SM, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4899 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_NoticeSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4900 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_TrapSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4901 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_OptionalIPDSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4902 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4903 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4904 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4905 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4906 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4907 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SMdisabled, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4908 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4909 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4910 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_CommunicationManagementSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4911 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4912 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_ReinitSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4913 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4914 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4915 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4916 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4917 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4918 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4919 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4920 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4921 proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported, tvb, local_offset, 4, ENC_BIG_ENDIAN);
4923 /* End Capability Mask Flags */
4925 /* Diag Code */
4926 temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_DiagCode, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4929 proto_item_append_text(temp_item, ", %s", val_to_str_const(temp_val, DiagCode, "Reserved DiagCode! Possible Error"));
4931 /* End Diag Code */
4933 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_KeyLeasePeriod, tvb, local_offset, 2, ENC_BIG_ENDIAN);
4935 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LocalPortNum, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4938 /* LinkWidthEnabled */
4939 temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkWidthEnabled, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4942 proto_item_append_text(temp_item, ", %s", val_to_str_const(temp_val, LinkWidthEnabled, "Reserved LinkWidthEnabled Value! Possible Error"));
4944 /* End LinkWidthEnabled */
4946 /* LinkWidthSupported */
4947 temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkWidthSupported, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4950 proto_item_append_text(temp_item, ", %s", val_to_str_const(temp_val, LinkWidthSupported, "Reserved LinkWidthSupported Value! Possible Error"));
4952 /* End LinkWidthSupported */
4954 /* LinkWidthActive */
4955 temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkWidthActive, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4958 proto_item_append_text(temp_item, ", %s", val_to_str_const(temp_val, LinkWidthActive, "Reserved LinkWidthActive Value! Possible Error"));
4960 /* End LinkWidthActive */
4962 /* LinkSpeedSupported */
4963 temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkSpeedSupported, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4966 /* 4 bit values = mask and shift */
4970 proto_item_append_text(temp_item, ", %s", val_to_str_const(temp_val, LinkSpeedSupported, "Reserved LinkWidthSupported Value! Possible Error"));
4971 /* End LinkSpeedSupported */
4973 /* PortState */
4974 temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PortState, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4977 /* 4 bit values = mask and shift */
4979 /*temp_val = temp_val >> 4 */
4981 proto_item_append_text(temp_item, ", %s", val_to_str_const(temp_val, PortState, "Reserved PortState Value! Possible Error"));
4983 /* End PortState */
4985 /* PortPhysicalState */
4986 temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PortPhysicalState, tvb, local_offset, 1, ENC_BIG_ENDIAN);
4989 /* 4 bit values = mask and shift */
4993 proto_item_append_text(temp_item, ", %s", val_to_str_const(temp_val, PortPhysicalState, "Reserved PortPhysicalState Value! Possible Error"));
4994 /* End PortPhysicalState */
4996 /* LinkDownDefaultState */
4997 temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkDownDefaultState, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5000 /* 4 bit values = mask and shift */
5002 /*temp_val = temp_val >> 4 */
5004 proto_item_append_text(temp_item, ", %s", val_to_str_const(temp_val, LinkDownDefaultState, "Reserved LinkDownDefaultState Value! Possible Error"));
5006 /* End LinkDownDefaultState */
5008 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_KeyProtectBits, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5009 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LMC, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5012 /* LinkSpeedActive */
5013 temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkSpeedActive, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5016 /* 4 bit values = mask and shift */
5020 proto_item_append_text(temp_item, ", %s", val_to_str_const(temp_val, LinkSpeedActive, "Reserved LinkSpeedActive Value! Possible Error"));
5021 /* End LinkSpeedActive */
5023 /* LinkSpeedEnabled */
5024 temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkSpeedEnabled, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5027 /* 4 bit values = mask and shift */
5029 /*temp_val = temp_val >> 4 */
5031 proto_item_append_text(temp_item, ", %s", val_to_str_const(temp_val, LinkSpeedEnabled, "Reserved LinkSpeedEnabled Value! Possible Error"));
5033 /* End LinkSpeedEnabled */
5035 /* NeighborMTU */
5036 temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_NeighborMTU, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5039 /* 4 bit values = mask and shift */
5043 proto_item_append_text(temp_item, ", %s", val_to_str_const(temp_val, NeighborMTU, "Reserved NeighborMTU Value! Possible Error"));
5045 /* End NeighborMTU */
5047 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MasterSMSL, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5050 /* VLCap */
5051 temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLCap, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5054 /* 4 bit values = mask and shift */
5058 proto_item_append_text(temp_item, ", %s", val_to_str_const(temp_val, VLCap, "Reserved VLCap Value! Possible Error"));
5060 /* End VLCap */
5062 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_InitType, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5064 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLHighLimit, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5066 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLArbitrationHighCap, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5068 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLArbitrationLowCap, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5070 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_InitTypeReply, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5072 /* MTUCap */
5073 temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MTUCap, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5076 /* 4 bit values = mask and shift */
5078 /*temp_val = temp_val >> 4 */
5080 proto_item_append_text(temp_item, ", %s", val_to_str_const(temp_val, MTUCap, "Reserved MTUCap Value! Possible Error"));
5082 /* End MTUCap */
5084 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLStallCount, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5085 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_HOQLife, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5088 /* OperationalVLs */
5089 temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_OperationalVLs, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5092 /* 4 bit values = mask and shift */
5096 proto_item_append_text(temp_item, ", %s", val_to_str_const(temp_val, OperationalVLs, "Reserved OperationalVLs Value! Possible Error"));
5097 /* End OperationalVLs */
5099 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PartitionEnforcementInbound, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5100 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PartitionEnforcementOutbound, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5101 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_FilterRawInbound, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5102 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_FilterRawOutbound, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5104 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_KeyViolations, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5106 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_P_KeyViolations, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5108 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_Q_KeyViolations, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5110 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_GUIDCap, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5112 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_ClientReregister, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5113 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_SubnetTimeOut, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5115 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_RespTimeValue, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5117 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LocalPhyErrors, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5118 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_OverrunErrors, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5120 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MaxCreditHint, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5122 proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkRoundTripLatency, tvb, local_offset, 3, ENC_BIG_ENDIAN);
5126 }
5128 /* Parse P_KeyTable Attribute
5129 * IN: parentTree - The tree to add the dissection to
5130 * tvb - The tvbbuff of packet data
5131 * offset - The offset in TVB where the attribute begins */
5133 {
5144 P_KeyTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_P_KeyTable_P_KeyTableBlock, tvb, local_offset, 64, ENC_NA);
5149 {
5150 tempItemLow = proto_tree_add_item(P_KeyTable_header_tree, hf_infiniband_P_KeyTable_MembershipType, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5151 tempItemHigh = proto_tree_add_item(P_KeyTable_header_tree, hf_infiniband_P_KeyTable_P_KeyBase, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5155 }
5156 }
5158 /* Parse SLtoVLMappingTable Attribute
5159 * IN: parentTree - The tree to add the dissection to
5160 * tvb - The tvbbuff of packet data
5161 * offset - The offset in TVB where the attribute begins */
5163 {
5174 SLtoVLMappingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, ENC_NA);
5176 SLtoVLMappingTable_header_tree = proto_item_add_subtree(SLtoVLMappingTable_header_item, ett_sltovlmapping);
5179 {
5180 tempItemLow = proto_tree_add_item(SLtoVLMappingTable_header_tree, hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5181 tempItemHigh = proto_tree_add_item(SLtoVLMappingTable_header_tree, hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5185 }
5186 }
5188 /* Parse VLArbitrationTable Attribute
5189 * IN: parentTree - The tree to add the dissection to
5190 * tvb - The tvbbuff of packet data
5191 * offset - The offset in TVB where the attribute begins */
5193 {
5204 VLArbitrationTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, ENC_NA);
5206 VLArbitrationTable_header_tree = proto_item_add_subtree(VLArbitrationTable_header_item, ett_vlarbitrationtable);
5209 {
5210 tempItemLow = proto_tree_add_item(VLArbitrationTable_header_tree, hf_infiniband_VLArbitrationTable_VL, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5212 tempItemHigh = proto_tree_add_item(VLArbitrationTable_header_tree, hf_infiniband_VLArbitrationTable_Weight, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5216 }
5217 }
5219 /* Parse LinearForwardingTable Attribute
5220 * IN: parentTree - The tree to add the dissection to
5221 * tvb - The tvbbuff of packet data
5222 * offset - The offset in TVB where the attribute begins */
5224 {
5234 LinearForwardingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, ENC_NA);
5236 LinearForwardingTable_header_tree = proto_item_add_subtree(LinearForwardingTable_header_item, ett_linearforwardingtable);
5239 {
5240 tempItemLow = proto_tree_add_item(LinearForwardingTable_header_tree, hf_infiniband_LinearForwardingTable_Port, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5243 }
5244 }
5246 /* Parse RandomForwardingTable Attribute
5247 * IN: parentTree - The tree to add the dissection to
5248 * tvb - The tvbbuff of packet data
5249 * offset - The offset in TVB where the attribute begins */
5251 {
5261 RandomForwardingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, ENC_NA);
5263 RandomForwardingTable_header_tree = proto_item_add_subtree(RandomForwardingTable_header_item, ett_randomforwardingtable);
5266 {
5267 tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_LID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5270 tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_Valid, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5272 tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_LMC, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5275 tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_Port, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5278 }
5279 }
5281 /* Parse NoticesAndTraps Attribute
5282 * IN: parentTree - The tree to add the dissection to
5283 * tvb - The tvbbuff of packet data
5284 * offset - The offset in TVB where the attribute begins */
5286 {
5296 MulticastForwardingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, ENC_NA);
5298 MulticastForwardingTable_header_tree = proto_item_add_subtree(MulticastForwardingTable_header_item, ett_multicastforwardingtable);
5301 {
5302 tempItemLow = proto_tree_add_item(MulticastForwardingTable_header_tree, hf_infiniband_MulticastForwardingTable_PortMask, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5305 }
5307 }
5309 /* Parse SMInfo Attribute
5310 * IN: parentTree - The tree to add the dissection to
5311 * tvb - The tvbbuff of packet data
5312 * offset - The offset in TVB where the attribute begins */
5314 {
5322 SMInfo_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, ENC_NA);
5326 proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_GUID, tvb, local_offset, 8, ENC_BIG_ENDIAN);
5328 proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_SM_Key, tvb, local_offset, 8, ENC_BIG_ENDIAN);
5330 proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_ActCount, tvb, local_offset, 4, ENC_BIG_ENDIAN);
5332 proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_Priority, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5333 proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_SMState, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5336 }
5338 /* Parse VendorDiag Attribute
5339 * IN: parentTree - The tree to add the dissection to
5340 * tvb - The tvbbuff of packet data
5341 * offset - The offset in TVB where the attribute begins */
5343 {
5351 VendorDiag_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, ENC_NA);
5355 proto_tree_add_item(VendorDiag_header_tree, hf_infiniband_VendorDiag_NextIndex, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5357 proto_tree_add_item(VendorDiag_header_tree, hf_infiniband_VendorDiag_DiagData, tvb, local_offset, 62, ENC_NA);
5361 }
5363 /* Parse LedInfo Attribute
5364 * IN: parentTree - The tree to add the dissection to
5365 * tvb - The tvbbuff of packet data
5366 * offset - The offset in TVB where the attribute begins */
5368 {
5376 LedInfo_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, ENC_NA);
5380 proto_tree_add_item(LedInfo_header_tree, hf_infiniband_LedInfo_LedMask, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5381 }
5383 /* Parse LinkSpeedWidthPairsTable Attribute
5384 * IN: parentTree - The tree to add the dissection to
5385 * tvb - The tvbbuff of packet data
5386 * offset - The offset in TVB where the attribute begins */
5388 {
5396 LinkSpeedWidthPairsTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, ENC_NA);
5398 LinkSpeedWidthPairsTable_header_tree = proto_item_add_subtree(LinkSpeedWidthPairsTable_header_item, ett_linkspeedwidthpairs);
5400 proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_NumTables, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5402 proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_PortMask, tvb, local_offset, 32, ENC_NA);
5404 proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5406 proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5408 proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5412 }
5414 /* Parse RID Field from Subnet Administration Packets.
5415 * IN: SA_header_tree - the dissection tree of the subnet admin attribute.
5416 * tvb - the packet buffer
5417 * MadHeader - the Common MAD header from this packet.
5418 * IN/OUT: offset - the current and updated offset in the packet buffer */
5419 static void parse_RID(proto_tree* SA_header_tree, tvbuff_t* tvb, int *offset, MAD_Data* MadHeader)
5420 {
5424 {
5426 }
5428 {
5430 /* NodeRecord */
5431 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5437 /* PortInfoRecord */
5438 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_EndportLID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5440 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_PortNum, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5446 /* SLtoVLMappingTableRecord */
5447 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5449 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_InputPortNum, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5451 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_OutputPortNum, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5457 /* SwitchInfoRecord */
5458 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5464 /* LinearForwardingTableRecord */
5465 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5467 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_SixteenBit, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5473 /* RandomForwardingTableRecord */
5474 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5476 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_SixteenBit, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5482 /* MulticastForwardingTableRecord */
5483 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5485 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_Position, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5486 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_NineBit, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5492 /* VLArbitrationTableRecord */
5493 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5495 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_OutputPortNum, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5497 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_EightBit, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5503 /* SMInfoRecord */
5504 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5510 /* P_KeyTableRecord */
5511 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5513 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_SixteenBit, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5515 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_PortNum, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5521 /* InformInfoRecord */
5522 proto_tree_add_item(SA_header_tree, hf_infiniband_InformInfoRecord_SubscriberGID, tvb, local_offset, 16, ENC_NA);
5524 proto_tree_add_item(SA_header_tree, hf_infiniband_InformInfoRecord_Enum, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5530 /* LinkRecord */
5531 proto_tree_add_item(SA_header_tree, hf_infiniband_LinkRecord_FromLID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5533 proto_tree_add_item(SA_header_tree, hf_infiniband_LinkRecord_FromPort, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5537 /* ServiceRecord */
5538 proto_tree_add_item(SA_header_tree, hf_infiniband_ServiceRecord_ServiceID, tvb, local_offset, 8, ENC_BIG_ENDIAN);
5540 proto_tree_add_item(SA_header_tree, hf_infiniband_ServiceRecord_ServiceGID, tvb, local_offset, 16, ENC_NA);
5542 proto_tree_add_item(SA_header_tree, hf_infiniband_ServiceRecord_ServiceP_Key, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5547 /* MCMemberRecord */
5548 proto_tree_add_item(SA_header_tree, hf_infiniband_MCMemberRecord_MGID, tvb, local_offset, 16, ENC_NA);
5550 proto_tree_add_item(SA_header_tree, hf_infiniband_MCMemberRecord_PortGID, tvb, local_offset, 16, ENC_NA);
5554 /* GuidInfoRecord */
5555 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5557 proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_EightBit, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5564 }
5567 }
5569 /* Parse InformInfo Attribute
5570 * IN: parentTree - The tree to add the dissection to
5571 * tvb - The tvbbuff of packet data
5572 * offset - The offset in TVB where the attribute begins */
5574 {
5580 {
5582 }
5583 InformInfo_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 36, ENC_NA);
5587 proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_GID, tvb, local_offset, 16, ENC_NA);
5589 proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_LIDRangeBegin, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5591 proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_LIDRangeEnd, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5593 proto_tree_add_item(InformInfo_header_tree, hf_infiniband_reserved, tvb, local_offset, 2, ENC_NA);
5595 proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_IsGeneric, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5597 proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_Subscribe, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5599 proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_Type, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5601 proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_TrapNumberDeviceID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5603 proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_QPN, tvb, local_offset, 3, ENC_BIG_ENDIAN);
5605 proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_RespTimeValue, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5607 proto_tree_add_item(InformInfo_header_tree, hf_infiniband_reserved, tvb, local_offset, 1, ENC_NA);
5609 proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_ProducerTypeVendorID, tvb, local_offset, 3, ENC_BIG_ENDIAN);
5613 }
5614 /* Parse LinkRecord Attribute
5615 * IN: parentTree - The tree to add the dissection to
5616 * tvb - The tvbbuff of packet data
5617 * offset - The offset in TVB where the attribute begins */
5619 {
5625 {
5627 }
5629 LinkRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 3, ENC_NA);
5633 proto_tree_add_item(LinkRecord_header_tree, hf_infiniband_LinkRecord_ToPort, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5635 proto_tree_add_item(LinkRecord_header_tree, hf_infiniband_LinkRecord_ToLID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5640 }
5641 /* Parse ServiceRecord Attribute
5642 * IN: parentTree - The tree to add the dissection to
5643 * tvb - The tvbbuff of packet data
5644 * offset - The offset in TVB where the attribute begins */
5646 {
5653 {
5655 }
5657 ServiceRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 176, ENC_NA);
5659 ServiceRecord_header_tree = proto_item_add_subtree(ServiceRecord_header_item, ett_servicerecord);
5661 proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceLease, tvb, local_offset, 4, ENC_BIG_ENDIAN);
5663 proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceKey, tvb, local_offset, 16, ENC_NA);
5665 proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceName, tvb, local_offset, 64, ENC_NA);
5668 tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData, tvb, local_offset, 16, ENC_NA);
5671 tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData, tvb, local_offset, 16, ENC_NA);
5674 tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData, tvb, local_offset, 16, ENC_NA);
5677 tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData, tvb, local_offset, 16, ENC_NA);
5683 }
5684 /* Parse PathRecord Attribute
5685 * IN: parentTree - The tree to add the dissection to
5686 * tvb - The tvbbuff of packet data
5687 * offset - The offset in TVB where the attribute begins */
5689 {
5695 {
5697 }
5699 PathRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 64, ENC_NA);
5702 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_reserved, tvb, local_offset, 8, ENC_NA);
5705 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_DGID, tvb, local_offset, 16, ENC_NA);
5707 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_SGID, tvb, local_offset, 16, ENC_NA);
5709 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_DLID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5711 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_SLID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5713 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_RawTraffic, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5714 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_FlowLabel, tvb, local_offset, 3, ENC_BIG_ENDIAN);
5716 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_HopLimit, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5718 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_TClass, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5720 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_Reversible, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5721 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_NumbPath, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5723 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_P_Key, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5725 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_SL, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5727 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_MTUSelector, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5728 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_MTU, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5730 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_RateSelector, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5731 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_Rate, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5733 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_PacketLifeTimeSelector, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5734 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_PacketLifeTime, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5736 proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_Preference, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5740 }
5741 /* Parse MCMemberRecord Attribute
5742 * IN: parentTree - The tree to add the dissection to
5743 * tvb - The tvbbuff of packet data
5744 * offset - The offset in TVB where the attribute begins */
5746 {
5752 {
5754 }
5756 MCMemberRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 64, ENC_NA);
5758 MCMemberRecord_header_tree = proto_item_add_subtree(MCMemberRecord_header_item, ett_mcmemberrecord);
5760 proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_Q_Key, tvb, local_offset, 4, ENC_BIG_ENDIAN);
5762 proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_MLID, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5764 proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_MTUSelector, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5765 proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_MTU, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5767 proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_TClass, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5769 proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_P_Key, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5771 proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_RateSelector, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5772 proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_Rate, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5774 proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_PacketLifeTimeSelector, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5775 proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_PacketLifeTime, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5777 proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_SL, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5778 proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_FlowLabel, tvb, local_offset, 3, ENC_BIG_ENDIAN);
5780 proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_HopLimit, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5782 proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_Scope, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5783 proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_JoinState, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5785 proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_ProxyJoin, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5790 }
5791 /* Parse TraceRecord Attribute
5792 * IN: parentTree - The tree to add the dissection to
5793 * tvb - The tvbbuff of packet data
5794 * offset - The offset in TVB where the attribute begins */
5796 {
5802 {
5804 }
5806 TraceRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 46, ENC_NA);
5810 proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_GIDPrefix, tvb, local_offset, 8, ENC_BIG_ENDIAN);
5812 proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_IDGeneration, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5814 proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_reserved, tvb, local_offset, 1, ENC_NA);
5816 proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_NodeType, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5818 proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_NodeID, tvb, local_offset, 8, ENC_BIG_ENDIAN);
5820 proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_ChassisID, tvb, local_offset, 8, ENC_BIG_ENDIAN);
5822 proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_EntryPortID, tvb, local_offset, 8, ENC_BIG_ENDIAN);
5824 proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_ExitPortID, tvb, local_offset, 8, ENC_BIG_ENDIAN);
5826 proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_EntryPort, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5828 proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_ExitPort, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5832 }
5833 /* Parse MultiPathRecord Attribute
5834 * IN: parentTree - The tree to add the dissection to
5835 * tvb - The tvbbuff of packet data
5836 * offset - The offset in TVB where the attribute begins */
5838 {
5848 {
5850 }
5852 MultiPathRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 200, ENC_NA);
5854 MultiPathRecord_header_tree = proto_item_add_subtree(MultiPathRecord_header_item, ett_multipathrecord);
5856 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_RawTraffic, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5857 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_FlowLabel, tvb, local_offset, 3, ENC_BIG_ENDIAN);
5859 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_HopLimit, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5861 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_TClass, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5863 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_Reversible, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5864 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_NumbPath, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5866 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_P_Key, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5868 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SL, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5870 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_MTUSelector, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5871 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_MTU, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5873 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_RateSelector, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5874 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_Rate, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5876 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_PacketLifeTimeSelector, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5877 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_PacketLifeTime, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5879 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_reserved, tvb, local_offset, 1, ENC_NA);
5881 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_IndependenceSelector, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5882 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_GIDScope, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5886 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SGIDCount, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5889 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_DGIDCount, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5891 proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_reserved, tvb, local_offset, 7, ENC_NA);
5895 {
5896 SDGID = proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SDGID, tvb, local_offset, 16, ENC_NA);
5899 }
5901 {
5902 SDGID = proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SDGID, tvb, local_offset, 16, ENC_NA);
5905 }
5908 }
5909 /* Parse ServiceAssociationRecord Attribute
5910 * IN: parentTree - The tree to add the dissection to
5911 * tvb - The tvbbuff of packet data
5912 * offset - The offset in TVB where the attribute begins */
5914 {
5920 {
5922 }
5924 ServiceAssociationRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 80, ENC_NA);
5926 ServiceAssociationRecord_header_tree = proto_item_add_subtree(ServiceAssociationRecord_header_item, ett_serviceassocrecord);
5928 proto_tree_add_item(ServiceAssociationRecord_header_tree, hf_infiniband_ServiceAssociationRecord_ServiceKey, tvb, local_offset, 16, ENC_NA);
5930 proto_tree_add_item(ServiceAssociationRecord_header_tree, hf_infiniband_ServiceAssociationRecord_ServiceName, tvb, local_offset, 64, ENC_ASCII);
5934 }
5936 /* Parse PortCounters MAD from the Performance management class.
5937 * IN: parentTree - The tree to add the dissection to
5938 * tvb - The tvbbuff of packet data
5939 * offset - The offset in TVB where the attribute begins
5940 * pinfo - The packet info structure with column information */
5941 static int parse_PERF_PortCounters(proto_tree* parentTree, tvbuff_t* tvb, packet_info *pinfo, int *offset)
5942 {
5949 perf_item = proto_tree_add_item(parentTree, hf_infiniband_PortCounters, tvb, local_offset, 40, ENC_NA);
5956 proto_tree_add_item(perf_tree, hf_infiniband_PortCounters_PortSelect, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5958 proto_tree_add_item(perf_tree, hf_infiniband_PortCounters_CounterSelect, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5960 proto_tree_add_item(perf_tree, hf_infiniband_PortCounters_SymbolErrorCounter, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5962 proto_tree_add_item(perf_tree, hf_infiniband_PortCounters_LinkErrorRecoveryCounter, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5964 proto_tree_add_item(perf_tree, hf_infiniband_PortCounters_LinkDownedCounter, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5966 proto_tree_add_item(perf_tree, hf_infiniband_PortCounters_PortRcvErrors, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5968 proto_tree_add_item(perf_tree, hf_infiniband_PortCounters_PortRcvRemotePhysicalErrors, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5970 proto_tree_add_item(perf_tree, hf_infiniband_PortCounters_PortRcvSwitchRelayErrors, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5972 proto_tree_add_item(perf_tree, hf_infiniband_PortCounters_PortXmitDiscards, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5974 proto_tree_add_item(perf_tree, hf_infiniband_PortCounters_PortXmitConstraintErrors, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5976 proto_tree_add_item(perf_tree, hf_infiniband_PortCounters_PortRcvConstraintErrors, tvb, local_offset, 1, ENC_BIG_ENDIAN);
5980 proto_tree_add_bits_item(perf_tree, hf_infiniband_PortCounters_LocalLinkIntegrityErrors, tvb, local_offset*8, 4, ENC_BIG_ENDIAN);
5981 proto_tree_add_bits_item(perf_tree, hf_infiniband_PortCounters_ExcessiveBufferOverrunErrors, tvb, local_offset*8 + 4, 4, ENC_BIG_ENDIAN);
5985 proto_tree_add_item(perf_tree, hf_infiniband_PortCounters_VL15Dropped, tvb, local_offset, 2, ENC_BIG_ENDIAN);
5987 proto_tree_add_item(perf_tree, hf_infiniband_PortCounters_PortXmitData, tvb, local_offset, 4, ENC_BIG_ENDIAN);
5989 proto_tree_add_item(perf_tree, hf_infiniband_PortCounters_PortRcvData, tvb, local_offset, 4, ENC_BIG_ENDIAN);
5991 proto_tree_add_item(perf_tree, hf_infiniband_PortCounters_PortXmitPkts, tvb, local_offset, 4, ENC_BIG_ENDIAN);
5993 proto_tree_add_item(perf_tree, hf_infiniband_PortCounters_PortRcvPkts, tvb, local_offset, 4, ENC_BIG_ENDIAN);
5996 *offset = local_offset; /* update caller's offset to point to end of the PortCounters payload */
5998 }
6000 /* Parse PortCountersExtended MAD from the Performance management class.
6001 * IN: parentTree - The tree to add the dissection to
6002 * tvb - The tvbbuff of packet data
6003 * offset - The offset in TVB where the attribute begins
6004 * pinfo - The packet info structure with column information */
6005 static int parse_PERF_PortCountersExtended(proto_tree* parentTree, tvbuff_t* tvb, packet_info *pinfo, int *offset)
6006 {
6013 perf_item = proto_tree_add_item(parentTree, hf_infiniband_PortCountersExt, tvb, local_offset, 72, ENC_NA);
6020 proto_tree_add_item(perf_tree, hf_infiniband_PortCountersExt_PortSelect, tvb, local_offset, 1, ENC_BIG_ENDIAN);
6022 proto_tree_add_item(perf_tree, hf_infiniband_PortCountersExt_CounterSelect, tvb, local_offset, 2, ENC_BIG_ENDIAN);
6026 proto_tree_add_item(perf_tree, hf_infiniband_PortCountersExt_PortXmitData, tvb, local_offset, 8, ENC_BIG_ENDIAN);
6028 proto_tree_add_item(perf_tree, hf_infiniband_PortCountersExt_PortRcvData, tvb, local_offset, 8, ENC_BIG_ENDIAN);
6030 proto_tree_add_item(perf_tree, hf_infiniband_PortCountersExt_PortXmitPkts, tvb, local_offset, 8, ENC_BIG_ENDIAN);
6032 proto_tree_add_item(perf_tree, hf_infiniband_PortCountersExt_PortRcvPkts, tvb, local_offset, 8, ENC_BIG_ENDIAN);
6034 proto_tree_add_item(perf_tree, hf_infiniband_PortCountersExt_PortUnicastXmitPkts, tvb, local_offset, 8, ENC_BIG_ENDIAN);
6036 proto_tree_add_item(perf_tree, hf_infiniband_PortCountersExt_PortUnicastRcvPkts, tvb, local_offset, 8, ENC_BIG_ENDIAN);
6038 proto_tree_add_item(perf_tree, hf_infiniband_PortCountersExt_PortMulticastXmitPkts, tvb, local_offset, 8, ENC_BIG_ENDIAN);
6040 proto_tree_add_item(perf_tree, hf_infiniband_PortCountersExt_PortMulticastRcvPkts, tvb, local_offset, 8, ENC_BIG_ENDIAN);
6043 *offset = local_offset; /* update caller's offset to point to end of the PortCountersExt payload */
6045 }
6047 /* dissect_general_info
6048 * Used to extract very few values from the packet in the case that full dissection is disabled by the user.
6049 * IN:
6050 * tvb - The tvbbuff of packet data
6051 * offset - The offset in TVB where the attribute begins
6052 * pinfo - The packet info structure with column information
6053 * starts_with - regular IB packet starts with LRH, ROCE starts with GRH and RROCE starts with BTH,
6054 * this tells the parser what headers of (LRH/GRH) to skip. */
6055 static void dissect_general_info(tvbuff_t *tvb, int offset, packet_info *pinfo, ib_packet_start_header starts_with)
6056 {
6058 bool bthFollows = false; /* Tracks if we are parsing a BTH. This is a significant decision point */
6060 int32_t nextHeaderSequence = -1; /* defined by this dissector. #define which indicates the upcoming header sequence from OpCode */
6063 MAD_Data MadData;
6065 /* BTH - Base Trasport Header */
6072 /* this is a RoCE packet, skip LRH parsing */
6075 }
6077 /* this is a RRoCE packet, skip LRH/GRH parsing and go directly to BTH */
6080 }
6086 /* Save Link Next Header... This tells us what the next header is. */
6091 /* Set destination in packet view. */
6098 /* Set Source in packet view. */
6105 skip_lrh:
6108 {
6114 /* Set source GID in packet view. */
6118 /* Set destination GID in packet view. */
6123 {
6124 /* Some kind of packet being transported globally with IBA, but locally it is not IBA - no BTH following. */
6126 }
6127 /* else
6128 * {
6129 * Fall through switch and start parsing Local Headers and BTH
6130 * }
6131 */
6132 /* FALL THROUGH */
6136 /* Get the OpCode - this tells us what headers are following */
6141 }
6142 col_append_str(pinfo->cinfo, COL_INFO, val_to_str_const((uint32_t)info.opCode, OpCodeMap, "Unknown OpCode "));
6146 /* Raw IPv6 Packet */
6154 }
6157 {
6158 /* Find our next header sequence based on the Opcode
6159 * Since we're not doing dissection here, we just need the proper offsets to get our labels in packet view */
6163 {
6269 }
6270 }
6272 {
6274 if (((management_class >= (uint8_t)VENDOR_1_START) && (management_class <= (uint8_t)VENDOR_1_END))
6275 || ((management_class >= (uint8_t)VENDOR_2_START) && (management_class <= (uint8_t)VENDOR_2_END)))
6276 {
6278 }
6279 else if ((management_class >= (uint8_t)APPLICATION_START) && (management_class <= (uint8_t)APPLICATION_END))
6280 {
6282 }
6286 {
6288 }
6290 {
6294 }
6295 }
6296 }
6299 }
6301 static void
6303 {
6305 }
6307 /* Protocol Registration */
6309 {
6312 /* Field dissector structures.
6313 * For reserved fields, reservedX denotes the reserved field is X bits in length.
6314 * e.g. reserved2 is a reserved field 2 bits in length.
6315 * The third parameter is a filter string associated for this field.
6316 * So for instance, to filter packets for a given virtual lane,
6317 * The filter (infiniband.LRH.vl == 3) or something similar would be used. */
6319 /* XXX: ToDo: Verify against Infiniband 1.2.1 Specification */
6320 /* Fields verified/corrected: Those after comment "XX: All following ..." */
6322 /* meanings for MAD method field */
6340 };
6343 /* Local Route Header (LRH) */
6347 },
6351 },
6355 },
6359 },
6363 },
6367 },
6371 },
6375 },
6379 },
6383 },
6385 /* Global Route Header (GRH) */
6389 },
6393 },
6397 },
6401 },
6405 },
6409 },
6413 },
6417 },
6421 },
6423 /* Base Transport Header (BTH) */
6427 },
6431 },
6435 },
6439 },
6443 },
6447 },
6451 },
6455 },
6459 },
6463 },
6467 },
6469 /* Raw Header (RWH) */
6473 },
6477 },
6479 /* Reliable Datagram Extended Transport Header (RDETH) */
6483 },
6487 },
6489 /* Datagram Extended Transport Header (DETH) */
6493 },
6497 },
6501 },
6503 /* RDMA Extended Transport Header (RETH) */
6507 },
6511 },
6515 },
6519 },
6521 /* Atomic Extended Transport Header (AtomicETH) */
6525 },
6526 #if 0
6530 },
6534 },
6535 #endif
6539 },
6543 },
6545 /* ACK Extended Transport Header (AETH) */
6549 },
6553 },
6557 },
6561 },
6565 },
6569 },
6573 },
6577 },
6581 },
6583 /* Atomic ACK Extended Transport Header (AtomicAckETH) */
6587 },
6591 },
6593 /* Immediate Extended Transport Header (ImmDT) */
6597 },
6599 /* Invalidate Extended Transport Header (IETH) */
6603 },
6605 /* FLUSH Extended Transport Header (FETH) */
6609 },
6613 },
6617 },
6621 },
6623 /* Payload */
6627 },
6631 },
6635 },
6639 },
6640 /* Unknown or Vendor Specific */
6644 },
6646 /* Common Reserved fields */
6650 },
6651 /* CM REQ Header */
6655 },
6659 },
6663 },
6667 },
6671 },
6675 },
6679 },
6683 },
6687 },
6691 },
6695 },
6699 },
6703 },
6707 },
6711 },
6715 },
6719 },
6723 },
6727 },
6731 },
6735 },
6739 },
6743 },
6747 },
6751 },
6755 },
6759 },
6763 },
6767 },
6771 },
6775 },
6779 },
6783 },
6787 },
6791 },
6795 },
6799 },
6803 },
6807 },
6811 },
6815 },
6819 },
6823 },
6827 },
6831 },
6835 },
6839 },
6843 },
6847 },
6851 },
6855 },
6859 },
6863 },
6867 },
6871 },
6875 },
6879 },
6883 },
6887 },
6891 },
6895 },
6899 },
6903 },
6907 },
6911 },
6915 },
6919 },
6920 /* CM REP Header */
6924 },
6928 },
6932 },
6936 },
6940 },
6944 },
6948 },
6952 },
6956 },
6960 },
6964 },
6968 },
6972 },
6976 },
6980 },
6984 },
6985 /* IB CM RTU Header */
6989 },
6993 },
6997 },
6998 /* CM REJ Header */
7002 },
7006 },
7010 },
7014 },
7018 },
7022 },
7026 },
7030 },
7034 },
7035 /* IB CM DREQ Header */
7039 },
7043 },
7047 },
7051 },
7052 /* IB CM DRSP Header */
7056 },
7060 },
7064 },
7066 /* MAD Base Header */
7070 },
7074 },
7078 },
7082 },
7086 },
7090 },
7094 },
7098 },
7102 },
7106 },
7110 },
7112 /* RMPP Header */
7116 },
7120 },
7124 },
7128 },
7132 },
7136 },
7140 },
7144 },
7146 /* RMPP Data */
7147 #if 0
7151 },
7152 #endif
7156 },
7160 },
7164 },
7166 /* RMPP ACK */
7170 },
7172 /* RMPP ABORT/STOP */
7176 },
7178 /* SMP Data (LID Routed) */
7182 },
7186 },
7190 },
7192 /* XX: All following verified/corrected against Infiniband 1.2.1 Specification */
7193 /* SMP Data Directed Route */
7197 },
7201 },
7205 },
7209 },
7213 },
7217 },
7221 },
7225 },
7229 },
7231 /* SA MAD Header */
7235 },
7239 },
7243 },
7247 },
7251 },
7253 /* NodeDescription */
7257 },
7259 /* NodeInfo */
7263 },
7267 },
7271 },
7275 },
7279 },
7283 },
7287 },
7291 },
7295 },
7299 },
7303 },
7307 },
7309 /* SwitchInfo */
7313 },
7317 },
7321 },
7325 },
7329 },
7333 },
7337 },
7341 },
7345 },
7347 "OptimizedSLtoVLMappingProgramming", "infiniband.switchinfo.optimizedsltovlmappingprogramming",
7349 },
7353 },
7357 },
7361 },
7365 },
7369 },
7373 },
7377 },
7379 /* GUIDInfo */
7380 #if 0
7384 },
7385 #endif
7389 },
7391 /* PortInfo */
7395 },
7399 },
7403 },
7407 },
7411 },
7413 /* Capability Mask Flags */
7417 },
7421 },
7425 },
7429 },
7431 "AutomaticMigrationSupported", "infiniband.portinfo.capabilitymask.automaticmigrationsupported",
7433 },
7437 },
7441 },
7445 },
7449 },
7453 },
7457 },
7459 "PKeySwitchExternalPortTrapSupported", "infiniband.portinfo.capabilitymask.pkeyswitchexternalporttrapsupported",
7461 },
7463 "CommunicationManagementSupported", "infiniband.portinfo.capabilitymask.communicationmanagementsupported",
7465 },
7469 },
7473 },
7477 },
7481 },
7485 },
7487 "CapabilityMaskNoticeSupported", "infiniband.portinfo.capabilitymask.capabilitymasknoticesupported",
7489 },
7493 },
7495 "LinkRoundTripLatencySupported", "infiniband.portinfo.capabilitymask.linkroundtriplatencysupported",
7497 },
7499 "ClientRegistrationSupported", "infiniband.portinfo.capabilitymask.clientregistrationsupported",
7501 },
7503 "OtherLocalChangesNoticeSupported", "infiniband.portinfo.capabilitymask.otherlocalchangesnoticesupported",
7505 },
7507 "LinkSpeedWIdthPairsTableSupported", "infiniband.portinfo.capabilitymask.linkspeedwidthpairstablesupported",
7509 },
7510 /* End Capability Mask Flags */
7512 /* PortInfo */
7516 },
7520 },
7524 },
7528 },
7532 },
7536 },
7540 },
7544 },
7548 },
7552 },
7556 },
7560 },
7564 },
7568 },
7572 },
7576 },
7580 },
7584 },
7588 },
7592 },
7596 },
7600 },
7604 },
7608 },
7612 },
7616 },
7620 },
7624 },
7628 },
7632 },
7636 },
7640 },
7644 },
7648 },
7652 },
7656 },
7660 },
7664 },
7668 },
7672 },
7676 },
7678 /* P_KeyTable */
7682 },
7686 },
7690 },
7692 /* SLtoVLMappingTable */
7696 },
7700 },
7702 /* VLArbitrationTable */
7703 #if 0
7707 },
7708 #endif
7712 },
7716 },
7718 /* LinearForwardingTable */
7719 #if 0
7723 },
7724 #endif
7728 },
7730 /* RandomForwardingTable */
7731 #if 0
7735 },
7736 #endif
7740 },
7744 },
7748 },
7752 },
7754 /* MulticastForwardingTable */
7755 #if 0
7757 "MulticastForwardingTableBlock", "infiniband.multicastforwardingtable.multicastforwardingtableblock",
7759 },
7760 #endif
7764 },
7766 /* SMInfo */
7770 },
7774 },
7778 },
7782 },
7786 },
7788 /* VendorDiag */
7792 },
7796 },
7798 /* LedInfo */
7802 },
7804 /* LinkSpeedWidthPairsTable */
7808 },
7812 },
7816 },
7820 },
7824 },
7826 /* NodeRecord */
7827 /* PortInfoRecord */
7828 /* SLtoVLMappingTableRecord */
7829 /* SwitchInfoRecord */
7830 /* LinearForwardingTableRecord */
7831 /* RandomForwardingTableRecord */
7832 /* MulticastForwardingTableRecord */
7833 /* VLArbitrationTableRecord */
7837 },
7841 },
7845 },
7849 },
7853 },
7857 },
7861 },
7865 },
7869 },
7870 #if 0
7874 },
7875 #endif
7877 /* InformInfoRecord */
7881 },
7885 },
7887 /* InformInfo */
7891 },
7895 },
7899 },
7903 },
7907 },
7911 },
7915 },
7919 },
7923 },
7927 },
7929 /* LinkRecord */
7933 },
7937 },
7941 },
7945 },
7947 /* ServiceRecord */
7951 },
7955 },
7959 },
7963 },
7967 },
7971 },
7975 },
7977 /* ServiceAssociationRecord */
7981 },
7985 },
7987 /* PathRecord */
7991 },
7995 },
7999 },
8003 },
8007 },
8011 },
8015 },
8019 },
8023 },
8027 },
8031 },
8035 },
8039 },
8043 },
8047 },
8051 },
8055 },
8059 },
8063 },
8065 /* MCMemberRecord */
8069 },
8073 },
8077 },
8081 },
8085 },
8089 },
8093 },
8097 },
8101 },
8105 },
8109 },
8113 },
8117 },
8121 },
8125 },
8129 },
8133 },
8137 },
8139 /* TraceRecord */
8143 },
8147 },
8151 },
8155 },
8159 },
8163 },
8167 },
8171 },
8175 },
8177 /* MultiPathRecord */
8181 },
8185 },
8189 },
8193 },
8197 },
8201 },
8205 },
8209 },
8213 },
8217 },
8221 },
8225 },
8229 },
8233 },
8237 },
8241 },
8245 },
8249 },
8253 },
8255 /* ClassPortInfo */
8259 },
8263 },
8267 },
8271 },
8275 },
8279 },
8283 },
8287 },
8291 },
8295 },
8299 },
8303 },
8307 },
8311 },
8315 },
8319 },
8323 },
8327 },
8331 },
8335 },
8339 },
8343 },
8345 /* Notice */
8349 },
8353 },
8357 },
8361 },
8365 },
8369 },
8373 },
8377 },
8378 #if 0
8382 },
8386 },
8387 #endif
8389 /* Traps 64,65,66,67 */
8393 },
8394 /* Traps 68,69 */
8398 },
8402 },
8403 #if 0
8407 },
8408 #endif
8410 /* Trap 128 */
8414 },
8416 /* Trap 129, 130, 131 */
8420 },
8422 /* Trap 144 */
8426 },
8430 },
8434 },
8438 },
8442 },
8444 /* Trap 145 */
8448 },
8450 /* Trap 256 */
8454 },
8458 },
8462 },
8466 },
8470 },
8474 },
8478 },
8482 },
8486 },
8488 /* Trap 257, 258 */
8492 },
8496 },
8500 },
8504 },
8508 },
8512 },
8516 },
8520 },
8522 /* Trap 259 */
8526 },
8530 },
8534 },
8535 /* ClassPortInfo in Performance class */
8540 },
8541 /* PortCounters in Performance class */
8546 },
8551 },
8556 },
8561 },
8566 },
8571 },
8576 },
8581 },
8586 HFILL}
8587 },
8592 },
8597 },
8602 },
8606 "The number of times the count of local physical errors exceeded the threshold specified by LocalPhyErrors",
8607 HFILL}
8608 },
8613 HFILL}
8614 },
8619 },
8624 },
8629 },
8634 },
8639 },
8640 /* PortCountersExtended in Performance class */
8645 },
8650 },
8655 },
8660 },
8665 },
8670 },
8675 },
8680 },
8685 },
8690 },
8695 }
8696 };
8698 /* Array to hold expansion options between dissections */
8700 /* &ett_infiniband, */
8729 /* &ett_nodedesc, */
8730 /* &ett_nodeinfo, */
8731 /* &ett_switchinfo, */
8732 /* &ett_guidinfo, */
8733 /* &ett_portinfo, */
8754 };
8760 },
8764 },
8768 },
8772 },
8776 }
8777 };
8780 &ett_link
8781 };
8784 /* Mellanox EoIB encapsulation header */
8788 },
8792 },
8796 },
8800 },
8804 },
8808 },
8812 },
8813 };
8816 &ett_eoib
8817 };
8825 /* register the subdissector tables */
8826 heur_dissectors_payload = register_heur_dissector_list_with_description("infiniband.payload", "InfiniBand payload", proto_infiniband);
8827 heur_dissectors_cm_private = register_heur_dissector_list_with_description("infiniband.mad.cm.private", "InfiniBand CM private data", proto_infiniband);
8829 /* register dissection preferences */
8842 proto_infiniband_link = proto_register_protocol("InfiniBand Link", "InfiniBand Link", "infiniband_link");
8843 ib_link_handle = register_dissector("infiniband_link", dissect_infiniband_link, proto_infiniband_link);
8848 proto_mellanox_eoib = proto_register_protocol("Mellanox EoIB Encapsulation Header", "Mellanox EoIB", "infiniband.eoib");
8852 /* initialize the hash table */
8856 subdissector_table = register_decode_as_next_proto(proto_infiniband, "infiniband", "Infiniband Payload",
8857 infiniband_payload_prompt);
8860 }
8862 /* Reg Handoff. Register dissectors we'll need for IPoIB and RoCE */
8864 {
8870 {
8871 dissector_handle_t roce_handle;
8876 /*
8877 * I haven't found an official spec for EoIB, but slide 10
8878 * of
8879 *
8880 * http://downloads.openfabrics.org/Media/Sonoma2009/Sonoma_2009_Tues_converged-net-bridging.pdf
8881 *
8882 * shows the "Eth Payload" following the "Eth Header" and optional
8883 * "Vlan tag", and doesn't show an FCS; "Payload" generally
8884 * refers to the data transported by the protocol, which wouldn't
8885 * include the FCS.
8886 *
8887 * In addition, the capture attached to bug 5061 includes no
8888 * Ethernet FCS.
8889 *
8890 * So we assume the Ethernet frames carried by EoIB don't include
8891 * the Ethernet FCS.
8892 */
8896 /* announce an anonymous Infiniband dissector */
8899 /* announce an anonymous Infiniband dissector */
8902 /* create and announce an anonymous RoCE dissector */
8906 /* create and announce an anonymous RRoCE dissector */
8909 /* RROCE over IPv4 isn't standardized but it's been seen in the wild */
8913 heur_dissector_add("infiniband.payload", dissect_mellanox_eoib, "Mellanox EoIB", "mellanox_eoib", proto_mellanox_eoib, HEURISTIC_ENABLE);
8915 /* This could be put in the ethernet dissector file, but since there are a few Infiniband fields in the encapsulation,
8916 keep the dissector here, but associate it with ethernet */
8918 heur_dissector_add("infiniband.payload", dissect_eth_over_ib, "Ethernet over IB", "eth_over_ib", proto_ethertype, HEURISTIC_ENABLE);
8921 }
8922 else
8923 {
8925 }
8926 /* We are saving the previous value of rroce udp port so we will be able to remove the dissector
8927 * the next time user pref is updated and we get called back to proto_reg_handoff_infiniband.
8928 * "Auto" preference not used because port isn't for the Infiniband protocol itself.
8929 */
8932 }
8934 /*
8935 * Editor modelines - https://www.wireshark.org/tools/modelines.html
8936 *
8937 * Local variables:
8938 * c-basic-offset: 4
8939 * tab-width: 8
8940 * indent-tabs-mode: nil
8941 * End:
8942 *
8943 * vi: set shiftwidth=4 tabstop=8 expandtab:
8944 * :indentSize=4:tabSize=8:noTabs=true:
8945 */